NDUFA8 Antibody

Images

 
Western Blot: NDUFA8 Antibody [NBP1-82661] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western Blot: NDUFA8 Antibody [NBP1-82661] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFA8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFA8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFA8 Protein (NBP1-82661PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFA8 Antibody

  • CI-19KD
  • CI-PGIV
  • complex I PGIV subunit
  • Complex I-19kD
  • Complex I-PGIV
  • MGC793
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
  • NADH:ubiquinone oxidoreductase PGIV subunit
  • NADH-ubiquinone oxidoreductase 19 kDa subunit
  • PGIV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00374291-P01
Species: Hu
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP1-92170
Species: Hu
Applications: WB, IHC, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
NBP1-88933
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00002954-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88938
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP2-19506
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NDUFA8 Antibody (NBP1-82661) (0)

There are no publications for NDUFA8 Antibody (NBP1-82661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA8 Antibody (NBP1-82661) (0)

There are no reviews for NDUFA8 Antibody (NBP1-82661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFA8 Antibody (NBP1-82661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFA8 Products

Bioinformatics Tool for NDUFA8 Antibody (NBP1-82661)

Discover related pathways, diseases and genes to NDUFA8 Antibody (NBP1-82661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA8 Antibody (NBP1-82661)

Discover more about diseases related to NDUFA8 Antibody (NBP1-82661).
 

Pathways for NDUFA8 Antibody (NBP1-82661)

View related products by pathway.

PTMs for NDUFA8 Antibody (NBP1-82661)

Learn more about PTMs related to NDUFA8 Antibody (NBP1-82661).

Blogs on NDUFA8

There are no specific blogs for NDUFA8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA8