NDUFB7 Antibody - Azide and BSA Free

Images

 
Western Blot: NDUFB7 Antibody [NBP2-94617] - Analysis of extracts of various cell lines, using NDUFB7 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per ...read more
Immunocytochemistry/ Immunofluorescence: NDUFB7 Antibody [NBP2-94617] - Analysis of L929 cells using NDUFB7 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFB7 Antibody [NBP2-94617] - Paraffin-embedded rat heart using NDUFB7 .
Immunohistochemistry-Paraffin: NDUFB7 Antibody [NBP2-94617] - Paraffin-embedded human esophageal using NDUFB7 .
Immunohistochemistry-Paraffin: NDUFB7 Antibody [NBP2-94617] - Paraffin-embedded mouse spleen using NDUFB7 .

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NDUFB7 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human NDUFB7 (NP_004137.2). MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFB7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for NDUFB7 Antibody - Azide and BSA Free

  • B18
  • Cell adhesion protein SQM1
  • CI-B18NADH-ubiquinone oxidoreductase B18 subunit
  • complex I B18 subunit
  • Complex I-B18
  • MGC2480
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

Background

NDUFB7 is encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NDUFB7 Antibody (NBP2-94617) (0)

There are no publications for NDUFB7 Antibody (NBP2-94617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB7 Antibody (NBP2-94617) (0)

There are no reviews for NDUFB7 Antibody (NBP2-94617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFB7 Antibody (NBP2-94617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB7 Products

Research Areas for NDUFB7 Antibody (NBP2-94617)

Find related products by research area.

Blogs on NDUFB7

There are no specific blogs for NDUFB7, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB7 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB7