NDUFB4 Antibody

Images

 
Western Blot: NDUFB4 Antibody [NBP2-33626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: NDUFB4 Antibody [NBP2-33626] - Staining of human cell line U-2 OS shows localization to nuclear membrane & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP2-33626] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP2-33626] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP2-33626] - Staining of human heart muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP2-33626] - Staining in human heart muscle and pancreas tissues using anti-NDUFB4 antibody. Corresponding NDUFB4 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NDUFB4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFB4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFB4 Protein (NBP2-33626PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFB4 Antibody

  • B15
  • CI-B15
  • complex I B15 subunit
  • Complex I-B15
  • MGC5105
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4 (15kD, B15)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
  • NADH-ubiquinone oxidoreductase B15 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Mu, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-93743
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82039
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-93366
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-88937
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-73857
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NDUFB4 Antibody (NBP2-33626) (0)

There are no publications for NDUFB4 Antibody (NBP2-33626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB4 Antibody (NBP2-33626) (0)

There are no reviews for NDUFB4 Antibody (NBP2-33626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFB4 Antibody (NBP2-33626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NDUFB4 Products

Bioinformatics Tool for NDUFB4 Antibody (NBP2-33626)

Discover related pathways, diseases and genes to NDUFB4 Antibody (NBP2-33626). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB4 Antibody (NBP2-33626)

Discover more about diseases related to NDUFB4 Antibody (NBP2-33626).
 

Pathways for NDUFB4 Antibody (NBP2-33626)

View related products by pathway.

PTMs for NDUFB4 Antibody (NBP2-33626)

Learn more about PTMs related to NDUFB4 Antibody (NBP2-33626).

Blogs on NDUFB4

There are no specific blogs for NDUFB4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB4
Uniprot