NDUFA3 Antibody

Images

 
Western Blot: NDUFA3 Antibody [H00004696-B01P] - Analysis of NDUFA3 expression in transfected 293T cell line by NDUFA3 polyclonal antibody. Lane 1: NDUFA3 transfected lysate(9.24 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDUFA3 Antibody Summary

Immunogen
NDUFA3 (NP_004533.1, 1 a.a. - 84 a.a.) full-length human protein. MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
Specificity
NDUFA3 - NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NDUFA3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFA3 Antibody

  • B9
  • CI-B9
  • complex I B9 subunit
  • Complex I-B9
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3 (9kD, B9)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
  • NADH-ubiquinone oxidoreductase B9 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5756
Species: Hu
Applications: Flow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00004696-B01P
Species: Hu
Applications: WB

Publications for NDUFA3 Antibody (H00004696-B01P) (0)

There are no publications for NDUFA3 Antibody (H00004696-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA3 Antibody (H00004696-B01P) (0)

There are no reviews for NDUFA3 Antibody (H00004696-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFA3 Antibody (H00004696-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFA3 Products

Bioinformatics Tool for NDUFA3 Antibody (H00004696-B01P)

Discover related pathways, diseases and genes to NDUFA3 Antibody (H00004696-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA3 Antibody (H00004696-B01P)

Discover more about diseases related to NDUFA3 Antibody (H00004696-B01P).
 

Pathways for NDUFA3 Antibody (H00004696-B01P)

View related products by pathway.

Blogs on NDUFA3

There are no specific blogs for NDUFA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA3
Entrez
Uniprot