NDUFA12 Antibody


Western Blot: NDUFA12 Antibody [NBP1-88935] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: NDUFA12 Antibody [NBP1-88935] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NDUFA12 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFA12 Protein (NBP1-88935PEP)
Read Publication using NBP1-88935.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NDUFA12 Antibody

  • 13 kDa differentiation-associated protein
  • B17.2,13kDa differentiation-associated protein
  • CIB17.2
  • CI-B17.2
  • complex I B17.2 subunit
  • Complex I-B17.2
  • DAP13NADH-ubiquinone oxidoreductase subunit B17.2
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
  • NADH: ubiquinone oxidoreductase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
Species: Hu, Rt
Applications: WB, ELISA, RNAi
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for NDUFA12 Antibody (NBP1-88935)(1)

Reviews for NDUFA12 Antibody (NBP1-88935) (0)

There are no reviews for NDUFA12 Antibody (NBP1-88935). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFA12 Antibody (NBP1-88935) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NDUFA12 Products

Bioinformatics Tool for NDUFA12 Antibody (NBP1-88935)

Discover related pathways, diseases and genes to NDUFA12 Antibody (NBP1-88935). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA12 Antibody (NBP1-88935)

Discover more about diseases related to NDUFA12 Antibody (NBP1-88935).

Pathways for NDUFA12 Antibody (NBP1-88935)

View related products by pathway.

PTMs for NDUFA12 Antibody (NBP1-88935)

Learn more about PTMs related to NDUFA12 Antibody (NBP1-88935).

Blogs on NDUFA12

There are no specific blogs for NDUFA12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFA12 Antibody and receive a gift card or discount.


Gene Symbol NDUFA12