NDUFAF3 Antibody

Images

 
Western Blot: NDUFAF3 Antibody [NBP1-89382] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: NDUFAF3 Antibody [NBP1-89382] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFAF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFAF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFAF3 Protein (NBP1-89382PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFAF3 Antibody

  • C3orf60
  • chromosome 3 open reading frame 60
  • DKFZp564J0123
  • DKFZP564J0123,2P1
  • E3-3
  • MGC10527
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
  • nuclear protein E3-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-92171
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-47359
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-89173
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89382
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for NDUFAF3 Antibody (NBP1-89382) (0)

There are no publications for NDUFAF3 Antibody (NBP1-89382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFAF3 Antibody (NBP1-89382) (0)

There are no reviews for NDUFAF3 Antibody (NBP1-89382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFAF3 Antibody (NBP1-89382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFAF3 Products

Bioinformatics Tool for NDUFAF3 Antibody (NBP1-89382)

Discover related pathways, diseases and genes to NDUFAF3 Antibody (NBP1-89382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFAF3 Antibody (NBP1-89382)

Discover more about diseases related to NDUFAF3 Antibody (NBP1-89382).
 

Pathways for NDUFAF3 Antibody (NBP1-89382)

View related products by pathway.

PTMs for NDUFAF3 Antibody (NBP1-89382)

Learn more about PTMs related to NDUFAF3 Antibody (NBP1-89382).

Blogs on NDUFAF3

There are no specific blogs for NDUFAF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFAF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFAF3