![Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human colorectal cancer shows moderate positivity.](http://images.novusbio.com/fullsize/Integrin-beta-like-protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-82473-img0011.jpg "Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human colorectal cancer shows moderate positivity.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Integrin beta-like protein 1 Antibody - BSA Free (NBP1-82473) is a polyclonal antibody validated for use in IHC and WB. Anti-Integrin beta-like protein 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGV |
| Predicted Species | Mouse (92%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ITGBL1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP1-82473 | Applications | Species |
|---|---|---|
| Huang, W, Yu, D Et al. ITGBL1 promotes cell migration and invasion through stimulating the TGF- beta signalling pathway in hepatocellular carcinoma. Cell Prolif 2020-07-01 [PMID: 32537856] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for Integrin beta-like protein 1 Antibody (NBP1-82473)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ITGBL1 |
![Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human lung shows strong cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/Integrin-beta-like-protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-82473-img0008.jpg "Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human lung shows strong cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Integrin-beta-like-protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-82473-img0009.jpg "Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Integrin-beta-like-protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-82473-img0010.jpg "Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")