Integrin beta-like protein 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human colorectal cancer shows moderate positivity.
Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin beta-like protein 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGV
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGBL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Integrin beta-like protein 1 Recombinant Protein Antigen (NBP1-82473PEP)
Publications
Read Publications using
NBP1-82473 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin beta-like protein 1 Antibody

  • Integrin beta-like 1
  • integrin, beta-like 1 (with EGF-like repeat domains)
  • ITGBL1
  • OSCP
  • OSCPITGBL1, integrin beta-like 1
  • Osteoblast-specific cysteine-rich protein
  • Ten integrin EGF-like repeat domain-containing protein
  • ten integrin EGF-like repeat domains protein
  • TIED
  • TIEDintegrin beta-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-99560
Species: Hu
Applications: ChIP, Flow-IC, Flow, IB, ICC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP2-15514
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00000514-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NB300-147
Species: Bv, Ca, Ch, Ha, Hu, Mu(-), Po, Rb, Rt, Xp
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-93442
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DY262
Species: Hu
Applications: ELISA
NBP1-88935
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NB600-41532
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for Integrin beta-like protein 1 Antibody (NBP1-82473)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-82473 Applications Species
Huang W, Yu D, Wang M et al. ITGBL1 Promotes Cell Migration and Invasion Through Stimulating the TGF-beta Signalling Pathway in Hepatocellular Carcinoma SSRN 2019 (IHC-P, Human) IHC-P Human
Huang, W, Yu, D Et al. ITGBL1 promotes cell migration and invasion through stimulating the TGF- beta signalling pathway in hepatocellular carcinoma. Cell Prolif Jul 1 2020 [PMID: 32537856] (WB, Mouse) WB Mouse

Reviews for Integrin beta-like protein 1 Antibody (NBP1-82473) (0)

There are no reviews for Integrin beta-like protein 1 Antibody (NBP1-82473). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin beta-like protein 1 Antibody (NBP1-82473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin beta-like protein 1 Products

Bioinformatics Tool for Integrin beta-like protein 1 Antibody (NBP1-82473)

Discover related pathways, diseases and genes to Integrin beta-like protein 1 Antibody (NBP1-82473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta-like protein 1 Antibody (NBP1-82473)

Discover more about diseases related to Integrin beta-like protein 1 Antibody (NBP1-82473).

Blogs on Integrin beta-like protein 1

There are no specific blogs for Integrin beta-like protein 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin beta-like protein 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGBL1