NDUFA11 Antibody - BSA Free

Western Blot: NDUFA11 Antibody [NBP2-83261] - WB Suggested Anti-NDUFA11 Antibody. Titration: 1.0 ug/ml. Positive Control: ACHN Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NDUFA11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFA11 Antibody - BSA Free (NBP2-83261) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of NDUFA11. Peptide sequence: GTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFA11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NDUFA11 Antibody - BSA Free

• B14.7
• CI-B14.7
• complex I B14.7 subunit
• Complex I-B14.7
• FLJ76501
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
• NADH-ubiquinone oxidoreductase subunit B14.7

Background

NDUFA11 is a component of mitochondrial complex I. Complex I catalyzes the first step in the electron transport chain,the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane(Carroll et al., 2002 (PubMed 12381726)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA11