PHYHIPL Antibody

Immunohistochemistry-Paraffin: PHYHIPL Antibody [NBP1-84858] - Staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PHYHIPL Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNI
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHYHIPL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PHYHIPL Protein (NBP1-84858PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHYHIPL Antibody

• Em:AC025038.1
• KIAA1796phytanoyl-CoA hydroxylase interacting protein-like
• phytanoyl-CoA 2-hydroxylase interacting protein-like
• phytanoyl-CoA hydroxylase-interacting protein-like

Background

PHYHIPL may play a role in the development of the central system

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHYHIPL Antibody (NBP1-84858)(1)

Publication using NBP1-84858

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: PHYHIPL