PHYHIPL Antibody

Images

 
Immunohistochemistry-Paraffin: PHYHIPL Antibody [NBP1-84858] - Staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHYHIPL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNI
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHYHIPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PHYHIPL Protein (NBP1-84858PEP)
Publications
Read Publication using NBP1-84858.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHYHIPL Antibody

  • Em:AC025038.1
  • KIAA1796phytanoyl-CoA hydroxylase interacting protein-like
  • phytanoyl-CoA 2-hydroxylase interacting protein-like
  • phytanoyl-CoA hydroxylase-interacting protein-like

Background

PHYHIPL may play a role in the development of the central system

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHYHIPL Antibody (NBP1-84858)(1)

Reviews for PHYHIPL Antibody (NBP1-84858) (0)

There are no reviews for PHYHIPL Antibody (NBP1-84858). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PHYHIPL Antibody (NBP1-84858) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHYHIPL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHYHIPL