Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ELISA, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | HRP |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human NDE1 (NP_060138.1). Sequence: MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQL |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | NDE1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Optimal dilution of this antibody should be experimentally determined. |
Storage | Store at 4C in the dark. |
Buffer | PBS |
Preservative | No Preservative |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NDE1 Antibody (NBP3-38386H)Find related products by research area.
|
CENPF Antibodies as Potential Cancer Markers Centromere protein F (CENPF), also named mitosin, is a large human protein of 3113 amino acid residues. Its expression and localization are cell cycle-dependent. The protein levels are low in G1 phase but elevated from S to early M phase. CENPF is a n... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | NDE1 |