NCOA3/AIB1 Recombinant Protein Antigen

Images

 
There are currently no images for NCOA3/AIB1 Recombinant Protein Antigen (NBP1-90256PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NCOA3/AIB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCOA3.

Source: E. coli

Amino Acid Sequence: PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCOA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90256.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NCOA3/AIB1 Recombinant Protein Antigen

  • ACTR
  • ACTRCBP-interacting protein
  • AIB1
  • AIB1AIB-1
  • Amplified in breast cancer 1 protein
  • BHLHE42
  • bHLHe42p/CIP
  • CAGH16
  • Class E basic helix-loop-helix protein 42
  • CTG26
  • KAT13B
  • MGC141848
  • NCOA3
  • NCoA-3
  • nuclear receptor coactivator 3
  • pCIP
  • pCIP
  • RAC3
  • RAC-3
  • RAC3pCIP
  • Receptor-associated coactivator 3
  • SRC-1
  • SRC3
  • SRC-3
  • SRC-3EC 2.3.1.48
  • Steroid receptor coactivator protein 3
  • Thyroid hormone receptor activator molecule 1
  • TNRC16
  • TRAM1
  • TRAM-1TNRC14

Background

NCOA3/SRC3 (nuclear receptor coactivator 3/steroid receptor coactivator 3 (SRC3)) is a 155 kD member of the p160/steroid receptor coactivator family containing a nuclear localization sequence, bHLH, and PAS domain. There are two reported isoforms of this protein. NCOA3/SRC3 is localized mainly in the cytoplasm, with weak nuclear expression. The protein is translocated to the nucleus upon phosphorylation. NCOA3/SRC3 is widely expressed with high expression in the heart, skeletal muscle, pancreas, and placenta and low expression in the brain. NCOA3/SRC3 is expressed at very low levels in the lung, liver, and kidney and overexpressed in breast and ovarian cancers. This protein has histone acetyltransferase activity and functions as a transcriptional coactivator for steroid and nuclear hormone receptors. Phosphorylation by I kappaB kinase enhances coactivator function. Acetylation by CREB-BP disrupts interaction with nuclear receptors. NCOA3/SRC3 forms a multisubunit coactivation complex with NCOA2 IKKA, IKKB, IKBKG and histone acetyltransferase protein CREB binding protein and has also been shown to interact with PCAF.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-541
Species: Am, Av, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-51531
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NB200-331
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-61050
Species: Hu
Applications: IHC,  IHC-P, IP, PLA, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
NBP1-90256PEP
Species: Hu
Applications: AC

Publications for NCOA3/AIB1 Recombinant Protein Antigen (NBP1-90256PEP) (0)

There are no publications for NCOA3/AIB1 Recombinant Protein Antigen (NBP1-90256PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA3/AIB1 Recombinant Protein Antigen (NBP1-90256PEP) (0)

There are no reviews for NCOA3/AIB1 Recombinant Protein Antigen (NBP1-90256PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCOA3/AIB1 Recombinant Protein Antigen (NBP1-90256PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCOA3/AIB1 Products

Research Areas for NCOA3/AIB1 Recombinant Protein Antigen (NBP1-90256PEP)

Find related products by research area.

Blogs on NCOA3/AIB1

There are no specific blogs for NCOA3/AIB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCOA3/AIB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOA3