We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human NCOA3/AIB1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Endotoxin, AP

Order Details

Recombinant Human NCOA3/AIB1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 251-360 of Human NCOA3/AIB1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NCOA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NCOA3/AIB1 GST (N-Term) Protein

  • ACTR
  • ACTRCBP-interacting protein
  • AIB1
  • AIB1AIB-1
  • Amplified in breast cancer 1 protein
  • BHLHE42
  • bHLHe42p/CIP
  • CAGH16
  • Class E basic helix-loop-helix protein 42
  • CTG26
  • KAT13B
  • MGC141848
  • NCOA3
  • NCoA-3
  • nuclear receptor coactivator 3
  • pCIP
  • pCIP
  • RAC3
  • RAC-3
  • RAC3pCIP
  • Receptor-associated coactivator 3
  • SRC-1
  • SRC3
  • SRC-3
  • SRC-3EC 2.3.1.48
  • Steroid receptor coactivator protein 3
  • Thyroid hormone receptor activator molecule 1
  • TNRC16
  • TRAM1
  • TRAM-1TNRC14

Background

NCOA3/SRC3 (nuclear receptor coactivator 3/steroid receptor coactivator 3 (SRC3)) is a 155 kD member of the p160/steroid receptor coactivator family containing a nuclear localization sequence, bHLH, and PAS domain. There are two reported isoforms of this protein. NCOA3/SRC3 is localized mainly in the cytoplasm, with weak nuclear expression. The protein is translocated to the nucleus upon phosphorylation. NCOA3/SRC3 is widely expressed with high expression in the heart, skeletal muscle, pancreas, and placenta and low expression in the brain. NCOA3/SRC3 is expressed at very low levels in the lung, liver, and kidney and overexpressed in breast and ovarian cancers. This protein has histone acetyltransferase activity and functions as a transcriptional coactivator for steroid and nuclear hormone receptors. Phosphorylation by I kappaB kinase enhances coactivator function. Acetylation by CREB-BP disrupts interaction with nuclear receptors. NCOA3/SRC3 forms a multisubunit coactivation complex with NCOA2 IKKA, IKKB, IKBKG and histone acetyltransferase protein CREB binding protein and has also been shown to interact with PCAF.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-541
Species: Am, Av, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-51531
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NB200-331
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-61050
Species: Hu
Applications: IHC,  IHC-P, IP, PLA, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-46388
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
1129-ER
Species: Hu
Applications: BA
H00008202-Q01
Species: Hu
Applications: WB, ELISA, Endotoxin, AP

Publications for NCOA3/AIB1 Partial Recombinant Protein (H00008202-Q01) (0)

There are no publications for NCOA3/AIB1 Partial Recombinant Protein (H00008202-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA3/AIB1 Partial Recombinant Protein (H00008202-Q01) (0)

There are no reviews for NCOA3/AIB1 Partial Recombinant Protein (H00008202-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCOA3/AIB1 Partial Recombinant Protein (H00008202-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCOA3/AIB1 Products

Research Areas for NCOA3/AIB1 Partial Recombinant Protein (H00008202-Q01)

Find related products by research area.

Blogs on NCOA3/AIB1

There are no specific blogs for NCOA3/AIB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NCOA3/AIB1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOA3