NCF4 Antibody

Images

 
Immunohistochemistry: NCF4 Antibody [NBP2-32720] - Staining of human spleen shows strong cytoplasmic positivity in a subset of cells in red pulp.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NCF4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NCF4 Protein (NBP2-32720PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCF4 Antibody

  • MGC3810
  • NCF
  • NCF-4
  • neutrophil cytosol factor 4
  • neutrophil cytosolic factor 4 (40kD)
  • neutrophil cytosolic factor 4, 40kDa
  • Neutrophil NADPH oxidase factor 4
  • p40phox
  • p40-phox
  • SH3 and PX domain-containing protein 4
  • SH3PXD4P40PHOX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP1-82542
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for NCF4 Antibody (NBP2-32720) (0)

There are no publications for NCF4 Antibody (NBP2-32720).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCF4 Antibody (NBP2-32720) (0)

There are no reviews for NCF4 Antibody (NBP2-32720). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NCF4 Antibody (NBP2-32720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCF4 Products

Bioinformatics Tool for NCF4 Antibody (NBP2-32720)

Discover related pathways, diseases and genes to NCF4 Antibody (NBP2-32720). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCF4 Antibody (NBP2-32720)

Discover more about diseases related to NCF4 Antibody (NBP2-32720).
 

Pathways for NCF4 Antibody (NBP2-32720)

View related products by pathway.

PTMs for NCF4 Antibody (NBP2-32720)

Learn more about PTMs related to NCF4 Antibody (NBP2-32720).
 

Research Areas for NCF4 Antibody (NBP2-32720)

Find related products by research area.

Blogs on NCF4

There are no specific blogs for NCF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCF4