NCF1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - Staining of human spleen shows high expression.

Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - Staining of human bone marrow shows moderate cytoplasmic positivity in a subset of hematopoietic cells.

Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - Staining in human spleen and cerebral cortex tissues using anti-NCF1 antibody. Corresponding NCF1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NCF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NCF1 Antibody - BSA Free (NBP2-33502) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENHQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NCF1 Protein (NBP2-33502PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NCF1 Antibody - BSA Free

• 47 kDa neutrophil oxidase factor
• FLJ79451
• NADPH oxidase organizer 2
• NCF-1
• NCF1A
• neutrophil cytosol factor 1,47 kDa autosomal chronic granulomatous disease protein
• neutrophil cytosolic factor 1 (47kD, chronic granulomatous disease, autosomal1)
• neutrophil cytosolic factor 1
• neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1)
• Neutrophil NADPH oxidase factor 1
• Nox organizer 2
• NOXO2NCF-47K
• Nox-organizing protein 2
• p47phox
• SH3 and PX domain-containing protein 1A
• SH3PXD1Ap47-phox

Background

NCF1, along with NCF2 and a membrane bound cytochrome b558, is required for activation of the latent NADPH oxidase necessary for superoxide production. Defects in NCF1 are the cause of autosomal cytochrome-b-positive chronic granulomatous disease type 1 (CGD). NCF1 is a cytosolic subunit of the multi-protein complex known as NADPH oxidase found in neutrophils.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCF1
• Uniprot:
  • P14598(Human)