NCAPG2 Antibody

Images

 
Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human tonsil shows moderate nuclear positivity in germinal center and non-germinal center cells.
Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: NCAPG2 Antibody [NBP1-86633] - Staining of human skeletal muscle shows weak to moderate nuclear positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NCAPG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCAPG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
131 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
NCAPG2 Protein (NBP1-86633PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCAPG2 Antibody

  • Chromosome-associated protein G2
  • FLJ20311
  • Leucine zipper protein 5CAP-G2hCAP-G2condensin-2 complex subunit G2
  • LUZP5
  • more than blood homolog
  • MTB
  • Non-SMC condensin II complex subunit G2
  • non-SMC condensin II complex, subunit G2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-52553
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-56413
Species: Hu
Applications: WB, ICC/IF
AF1235
Species: Hu
Applications: WB, IHC
NBP2-56060
Species: Hu
Applications: ICC/IF
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00030813-R02
Species: Hu
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-86633
Species: Hu
Applications: IHC, IHC-P

Publications for NCAPG2 Antibody (NBP1-86633) (0)

There are no publications for NCAPG2 Antibody (NBP1-86633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCAPG2 Antibody (NBP1-86633) (0)

There are no reviews for NCAPG2 Antibody (NBP1-86633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NCAPG2 Antibody (NBP1-86633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCAPG2 Products

Bioinformatics Tool for NCAPG2 Antibody (NBP1-86633)

Discover related pathways, diseases and genes to NCAPG2 Antibody (NBP1-86633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCAPG2 Antibody (NBP1-86633)

Discover more about diseases related to NCAPG2 Antibody (NBP1-86633).
 

Pathways for NCAPG2 Antibody (NBP1-86633)

View related products by pathway.

PTMs for NCAPG2 Antibody (NBP1-86633)

Learn more about PTMs related to NCAPG2 Antibody (NBP1-86633).

Blogs on NCAPG2

There are no specific blogs for NCAPG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCAPG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAPG2
Entrez
Uniprot