NAPE-PLD Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NAPE-PLD Antibody [NBP1-88248] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAPE-PLD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAPEPLD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAPE-PLD Protein (NBP1-88248PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAPE-PLD Antibody

  • C7orf18
  • DKFZp781D1098
  • EC 3.1.4
  • EC 3.1.4.-
  • N-acyl phosphatidylethanolamine phospholipase DNAPE-PLDFMP30
  • N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
  • NAPE-hydrolyzing phospholipase D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
AF4886
Species: Mu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB110-60930
Species: Hu, Mu
Applications: WB
NBP1-69654
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NAPE-PLD Antibody (NBP1-88248) (0)

There are no publications for NAPE-PLD Antibody (NBP1-88248).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAPE-PLD Antibody (NBP1-88248) (0)

There are no reviews for NAPE-PLD Antibody (NBP1-88248). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NAPE-PLD Antibody (NBP1-88248) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAPE-PLD Products

Bioinformatics Tool for NAPE-PLD Antibody (NBP1-88248)

Discover related pathways, diseases and genes to NAPE-PLD Antibody (NBP1-88248). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAPE-PLD Antibody (NBP1-88248)

Discover more about diseases related to NAPE-PLD Antibody (NBP1-88248).

Research Areas for NAPE-PLD Antibody (NBP1-88248)

Find related products by research area.

Blogs on NAPE-PLD

There are no specific blogs for NAPE-PLD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAPE-PLD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAPEPLD