We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NALP6 Recombinant Protein Antigen

Images

 
There are currently no images for NALP6 Protein (NBP2-47362PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NALP6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP6.

Source: E. coli

Amino Acid Sequence: GEEPNYPLELLYCLYETQEDAFVRQALCRFPELALQRVRFCRMDVAVLSYCVRCCPAGQALRLISCRLVAAQEKKKKSLGKRLQASLGGGSSSQGTTKQLPASLLHPLFQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NLRP6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47362.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NALP6 Recombinant Protein Antigen

  • Angiotensin II/Vasopressin Receptor
  • AVR
  • CLR11.4
  • NACHT, Leucine Rich Repeat And PYD Containing 6
  • NACHT, LRR And PYD Containing Protein 6
  • NACHT, LRR And PYD Domains-Containing Protein 6
  • NALP6
  • NAVR
  • NAVR/AVR
  • NLR Family, Pyrin Domain Containing 6
  • NLRP6
  • NLRP6
  • Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And Pyrin Domain Containing 6
  • PAN3
  • PYPAF5
  • PYRIN-Containing APAF1-Like Protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
7625
Species: Mu
Applications: ELISA
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-78979
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P
NB100-56155
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-56156
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-54899
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-90095
Species: Hu
Applications:  IHC-P
NBP1-76293
Species: Hu, Mu, Rt, V-Vi
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-27354
Species: Hu
Applications: WB
NBP2-69822
Species: Hu
Applications: ELISA
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-92186
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-48703
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, WB
NBP2-73847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-47362PEP
Species: Hu
Applications: AC

Publications for NALP6 Protein (NBP2-47362PEP) (0)

There are no publications for NALP6 Protein (NBP2-47362PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NALP6 Protein (NBP2-47362PEP) (0)

There are no reviews for NALP6 Protein (NBP2-47362PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NALP6 Protein (NBP2-47362PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NALP6 Products

Array NBP2-47362PEP

Research Areas for NALP6 Protein (NBP2-47362PEP)

Find related products by research area.

Blogs on NALP6.

Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.

NALP6 - plays a critical role in suppressing inflammation and tumorigenesis
NALP6 belongs to the NLRP family of which function as innate sensors of endogenous and exogenous stress and damage-associated molecular patterns (DAMPs). NLRPs are vital components of the inflammasome which is the cytoplasmic multiprotein complex that...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NALP6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP6