NALP12 Antibody - BSA Free

Western Blot: NALP12 Antibody [NBP2-87879] - Host: Rabbit. Target Name: NLRP12. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NALP12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NALP12 Antibody - BSA Free (NBP2-87879) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NALP12. Peptide sequence: LEVSLVTPRKDPQETYRDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NLRP12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NALP12 Antibody - BSA Free

• FCAS2
• Monarch-1
• NACHT, leucine rich repeat and PYD containing 12
• NACHT, LRR and PYD domains-containing protein 12
• NALP12LRR and PYD containing protein 12
• NLR family, pyrin domain containing 12
• nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 12
• PYPAF7Monarch1
• PYRIN-containing APAF1-like protein 7
• Regulated by nitric oxide
• RNO2

Background

NALPs are cytoplasmic proteins that form a subfamily within the larger CATERPILLER protein family. Most short NALPs, such as NALP12, have an N-terminal pyrin (MEFV; MIM 608107) domain (PYD), followed by a NACHT domain, a NACHT-associated domain (NAD), and a C-terminal leucine-rich repeat (LRR) region. The long NALP, NALP1 (MIM 606636), also has a C-terminal extension containing a function to find domain (FIIND) and a caspase recruitment domain (CARD). NALPs are implicated in the activation of proinflammatory caspases (e.g., CASP1; MIM 147678) via their involvement in multiprotein complexes called inflammasomes. NALP12 may mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NLRP12