NAIP Antibody

Images

 
Immunohistochemistry: NAIP Antibody [NBP1-88596] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NAIP Protein (NBP1-88596PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAIP Antibody

  • baculoviral IAP repeat-containing 1
  • BIRC1
  • BIRC1baculoviral IAP repeat-containing protein 1
  • FLJ18088
  • FLJ42520
  • FLJ58811
  • NAIP
  • Neuronal apoptosis inhibitory protein
  • NLR family, apoptosis inhibitory protein
  • NLR family, BIR domain containing 1
  • NLRB1
  • nucleotide-binding oligomerization domain, leucine rich repeat and BIR domaincontaining 1
  • psi neuronal apoptosis inhibitory protein
  • psiNAIP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-37387
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56142
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88596
Species: Hu
Applications: IHC, IHC-P

Publications for NAIP Antibody (NBP1-88596) (0)

There are no publications for NAIP Antibody (NBP1-88596).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAIP Antibody (NBP1-88596) (0)

There are no reviews for NAIP Antibody (NBP1-88596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NAIP Antibody (NBP1-88596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAIP Products

Bioinformatics Tool for NAIP Antibody (NBP1-88596)

Discover related pathways, diseases and genes to NAIP Antibody (NBP1-88596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAIP Antibody (NBP1-88596)

Discover more about diseases related to NAIP Antibody (NBP1-88596).
 

Pathways for NAIP Antibody (NBP1-88596)

View related products by pathway.

PTMs for NAIP Antibody (NBP1-88596)

Learn more about PTMs related to NAIP Antibody (NBP1-88596).
 

Research Areas for NAIP Antibody (NBP1-88596)

Find related products by research area.

Blogs on NAIP.

Survivin - an inhibitor of apoptosis protein
Survivin is an anti-apoptotic protein which is the smallest protein within a large family of proteins including X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, NAIP, and Livin. Survivin is responsible for a wide range of basic cellula...  Read full blog post.

Survivin is thrivin'
The survivin anti-apoptotic protein is the smallest member of a large family of proteins such as X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, Livin, and NAIP. Survivin regulates basic physiological events such as the cell cycle, tumor...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAIP
Entrez