Myt1 Antibody (2A7)

Images

 
There are currently no images for Myt1 Antibody (H00004661-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Myt1 Antibody (2A7) Summary

Immunogen
MYT1 (NP_004526 586 a.a. - 685 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS
Specificity
MYT1
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
MYT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myt1 Antibody (2A7)

  • C20orf36
  • MTF1proteolipid protein binding protein
  • myelin transcription factor 1
  • Myelin transcription factor I
  • MyT1
  • MyTI
  • MYTIKIAA0835
  • PLPB1KIAA1050
  • Proteolipid protein-binding protein

Background

The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-02275
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-07219
Species: Hu
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
AF3444
Species: Hu
Applications: WB
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P

Publications for Myt1 Antibody (H00004661-M02) (0)

There are no publications for Myt1 Antibody (H00004661-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myt1 Antibody (H00004661-M02) (0)

There are no reviews for Myt1 Antibody (H00004661-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myt1 Antibody (H00004661-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myt1 Products

Bioinformatics Tool for Myt1 Antibody (H00004661-M02)

Discover related pathways, diseases and genes to Myt1 Antibody (H00004661-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myt1 Antibody (H00004661-M02)

Discover more about diseases related to Myt1 Antibody (H00004661-M02).
 

Pathways for Myt1 Antibody (H00004661-M02)

View related products by pathway.

PTMs for Myt1 Antibody (H00004661-M02)

Learn more about PTMs related to Myt1 Antibody (H00004661-M02).
 

Research Areas for Myt1 Antibody (H00004661-M02)

Find related products by research area.

Blogs on Myt1

There are no specific blogs for Myt1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myt1 Antibody (2A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYT1
Entrez
OMIM
Uniprot