Myosin Light Chain 2 Antibody

Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart muscle and pancreas tissues. Corresponding Myosin Light Chain 2 RNA-seq data are presented for the same tissues.

Western Blot: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart tissue.

Immunohistochemistry-Frozen: Myosin Light Chain 2 Antibody [NBP1-85541] - Mlc2v staining on E11.5 mouse Right Ventricle. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody at 1ug/mL. Secondary antibody at 1:1000, conjugated to Alexa Fluor 488. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Myosin Light Chain 2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25299188). For IHC-Paraffin, HIER pH 6 retrieval is recommended. This Myosin Light Chain 2 Antibody is validated for IHC-Fr from a verified customer review.
• Control Peptide:

  Myosin Light Chain 2 Protein (NBP1-85541PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25299188). Rat (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Myosin Light Chain 2 Antibody

• cardiac ventricular myosin light chain 2
• CMH10myosin light chain 2
• DKFZp779C0562
• MLC2
• MLC-2
• MLC-2v
• myosin regulatory light chain 2, ventricular/cardiac muscle isoform
• myosin, light chain 2, regulatory, cardiac, slow
• myosin, light polypeptide 2, regulatory, cardiac, slow
• regulatory light chain of myosin
• RLC of myosin
• slow cardiac myosin regulatory light chain 2

Background

MYL2 (myosin, light chain 2, regulatory, cardiac, slow), also known as MLC-2, MLC2v. Entrez protein NP_000423. MYL2 associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. It is an hexamer of two heavy chains and four light chains that is predominantly expressed in adult cardiac ventricle muscle. Mutations in MYL2 are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Myosin Light Chain 2 Antibody (NBP1-85541)(2)

Publications using NBP1-85541

• Prashan Z, Jiang L, Omar T et al. Delta-like ligand 4-mediated Notch signaling controls proliferation of second heart field progenitor cells by regulating Fgf8 expression Development 2020-09-11 [PMID: 32778568] (IF/IHC, Mouse)
• He L, Tian X, Zhang H et al. BAF200 Is Required for Heart Morphogenesis and Coronary Artery Development. PLoS One 2014-01-01 [PMID: 25299188] (IF/IHC, Mouse)

Review for Myosin Light Chain 2 Antibody (NBP1-85541) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Prashan De Zoysa IHC-Fr Mouse 01/07/2021

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: E11.5 mouse embryo fixed in 4% PFA
• Species: Mouse
• Lot: A57970

Comments

• Comments: Fixed 4% PFA overnight.
  Blocked with 1% BSA
  Primary antibody concentration - 1ug/mL
  Secondary antibody - Invitrogen Alexa Fluor 488
  Secondary antibody - 1:1000

Bioinformatics

• Gene Symbol: MYL2