Home » Myosin Light Chain 2 » Myosin Light Chain 2 Antibodies » Myosin Light Chain 2 Antibody

Myosin Light Chain 2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Myosin Light Chain 2 Antibody [NBP1-85541] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Myosin Light Chain 2 Antibody [NBP1-85541] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Myosin Light Chain 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE
Specificity
Specificity of human, mouse Myosin Light Chain 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Myosin Light Chain 2 Protein (NBP1-85541PEP)
Publications
Read Publication using
NBP1-85541 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25299188). Rat (82%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin Light Chain 2 Antibody

  • cardiac ventricular myosin light chain 2
  • CMH10myosin light chain 2
  • DKFZp779C0562
  • MLC2
  • MLC-2
  • MLC-2v
  • myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  • myosin, light chain 2, regulatory, cardiac, slow
  • myosin, light polypeptide 2, regulatory, cardiac, slow
  • regulatory light chain of myosin
  • RLC of myosin
  • slow cardiac myosin regulatory light chain 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MLC1 Antibody
NBP1-80073
Western Blot: MLC1 Antibody [NBP1-80073] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-80073] - Rat Astrocytes, 20 ug/ml.
Western Blot: MLC1 Antibody [NBP1-80073] - Human Fetal Spleen, Antibody Dilution: 1.0 ug/ml.
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Myosin Heavy Chain was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(22 Publications)
Species: Multi
Applications: WB, ICC
RhoD Antibody
(OTI2F7)
NBP2-01462
Western Blot: RhoD Antibody (2F7) [NBP2-01462] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RhoD (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RhoD.
Immunocytochemistry/Immunofluorescence: RhoD Antibody (2F7) [NBP2-01462] Staining of COS7 cells transiently transfected by pCMV6-ENTRY RhoD.
Flow Cytometry: RhoD Antibody (2F7) [NBP2-01462] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RhoD antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, ICC/IF
Rhodopsin Antibody
(A531)
NBP2-25159
Western Blot: Rhodopsin Antibody (A531) [NBP2-25159] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important not to boil a sample containing it in SDS-PAGE sample buffer, as this will result in more extensive aggregation of the Rhodopsin protein.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (A531) [NBP2-25159] - Pig retinal section stained with NBP2-25159 (green) and counterstained with rabbit polyclonal antibody to NF-M NB300-133 (red) and DNA (blue). Rhodopsin is most abundant in the outer segments of retina (OS), NF-M is abundant in the optic nerve fiber layer (ONFL), but seen in processes and neurons in other regions also. Other layers are pigmented epithelium (PE), outer and inner nuclear layers (ONL, INL), outer and inner plexiform layers (OPL, IPL) and ganglion cell layer (GCL).
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Myosin light chain
kinase Antibody (SU40 ...
NBP2-67486
Western Blot: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Analysis of MYLK on human lung lysates using anti-MYLK antibody at 1/5,000 dilution.
Immunocytochemistry/Immunofluorescence: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Staining MYLK in L6 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Analysis of paraffin-embedded rat smooth muscle tissue using anti-MYLK antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Atrial Natriuretic
Peptide/ANP Antibody
NBP2-14873
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Mouse tissue extracts (50 ug) was separated by 15 % SDS-PAGE, and the membrane was blotted with ANP antibody diluted by 1:5000.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Paraffin-embedded mouse muscle. ANP antibody [N1C3] ) diluted at 1:500.
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Rat tissue extract (50 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with ANP antibody [N1C3] diluted at 1:2000.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MYLK3 Antibody
NBP2-62682
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Analysis in human heart muscle and pancreas tissues using Anti-MYLK3 antibody. Corresponding MYLK3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: IHC
NKX2.5 Antibody
NBP1-31558
Western Blot: NKX2.5 Antibody [NBP1-31558] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Nkx2.5 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NKX2.5 Antibody [NBP1-31558] - Paraformaldehyde-fixed mouse ESC D3, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: NKX2.5 Antibody [NBP1-31558] - Paraffin-embedded rat heart. Nkx2.5 stained by Nkx2.5 antibody diluted at 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MYL7 Antibody
(OTI4E7)
NBP2-03891
Western Blot: MYL7 Antibody (4E7) [NBP2-03891] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MYL7 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MYL7.
Immunohistochemistry-Paraffin: MYL7 Antibody (4E7) [NBP2-03891] Staining of paraffin-embedded Human liver tissue using anti-MYL7 mouse monoclonal antibody.
Flow Cytometry: MYL7 Antibody (4E7) [NBP2-03891] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-MYL7 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Troponin I Type 3
(cardiac) Antibody (1 ...
NB110-2546
Flow Cytometry: Troponin I Type 3 (cardiac) Antibody (19C7) [NB110-2546] - FACS analysis of Troponin I Type 3 in differentiated ESC cultures using anti-Troponin I Type 3 (cardiac) antibody. Image from verified customer review.
Chromatin Immunoprecipitation: Troponin I Type 3 (cardiac) Antibody (19C7) [NB110-2546] - Analysis of murine early primitive ectoderm-like cells, staining Cardiac Troponin I.
Immunoassay: Troponin I Type 3 (cardiac) Antibody (19C7) [NB110-2546] - recognized dephospho-(light blue 19C7) and biphospho-(dark blue 22B11) forms of cTnl.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, ChIP, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
MYH7 Antibody
(940906) [Unconjugate
MAB9096
MYH7 was detected in immersion fixed paraffin-embedded sections of human heart using Mouse Anti-Human MYH7 Monoclonal Antibody (Catalog # MAB9096) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human skeletal muscle tissue and human heart (atrium) tissue. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human MYH7 Monoclonal Antibody (Catalog # MAB9096) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for MYH7 at approximately 230 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB, IHC
MHC Class I
Antibody (OX18)
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MHC Class I Antibody (OX18) [NB120-6405] - IHC analysis of formalin fixed paraffin-embedded (FFPE) rat brain cerebellum using MHC Class I (OK18) antibody at 1:200 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Endothelial staining was observed. Staining was performed by Histowiz.
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
(29 Publications)
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Myosin light chain
3 Antibody
NBP1-88068
Western Blot: Myosin light chain 3 Antibody [NBP1-88068] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human cell line A-431 shows positivity in nucleoli and mitochondria.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human skeletal muscle shows high expression.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MyoD Antibody
(5.8A)
NB100-56511
Western Blot: MyoD Antibody (5.8A) [NB100-56511] - Analysis for MyoD expression in various small round cell tumor lines using 1 ug/ml anti-MyoD mAb. The antibody only reacts with a band of approx. 45 kD in the rhabdomyosarcoma cell line (Rh30, lane 1) but was negative against the primitive neuroectodermal (PFSK-1A, lane 2), lymphoma (EB2, lane 3), neuroblastoma (SK-N-SH, lane 4), and Ewing's sarcoma (SJSA-1, lane 5) cell lines.
Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - RD cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MyoD1 (5.8A) NB100-56511 at a 1:200 dilution overnight at 4C and detected with and anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: MyoD Antibody (5.8A) [NB100-56511] - IHC (F) using the MyoD1, Clone 5.8A antibody in human tissues. A. Rhabdomyosaroma (nuclei are stained), B. Lymphoma (staining is absent)
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
MRLC2 Antibody
NBP2-54719
Western Blot: MRCL3 Antibody [NBP2-54719] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: MRLC2 Antibody [NBP2-54719] - MRCL3 Antibody [NBP2-54719] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: MRCL3 Antibody [NBP2-54719] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
HESX1 Antibody
NBP1-89090
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts as well as in Leydig cells.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: IHC, IHC-P
Troponin C
(cardiac) Antibody
NBP2-55151
Immunocytochemistry/Immunofluorescence: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human cell line HeLa shows localization to nucleoplasm, mitochondria & actin filaments.
Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining in human heart muscle and prostate tissues using anti-TNNC1 antibody. Corresponding TNNC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human heart muscle shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Calmodulin 3
Antibody
NBP1-98474
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Species: Hu
Applications: WB

Publications for Myosin Light Chain 2 Antibody (NBP1-85541)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Myosin Light Chain 2 Antibody (NBP1-85541) (0)

There are no reviews for Myosin Light Chain 2 Antibody (NBP1-85541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin Light Chain 2 Antibody (NBP1-85541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin Light Chain 2 Products

Bioinformatics Tool for Myosin Light Chain 2 Antibody (NBP1-85541)

Discover related pathways, diseases and genes to Myosin Light Chain 2 Antibody (NBP1-85541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin Light Chain 2 Antibody (NBP1-85541)

Discover more about diseases related to Myosin Light Chain 2 Antibody (NBP1-85541).
 

Pathways for Myosin Light Chain 2 Antibody (NBP1-85541)

View related products by pathway.

PTMs for Myosin Light Chain 2 Antibody (NBP1-85541)

Learn more about PTMs related to Myosin Light Chain 2 Antibody (NBP1-85541).

Blogs on Myosin Light Chain 2

There are no specific blogs for Myosin Light Chain 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin Light Chain 2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MYL2