New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Myosin Light Chain 2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart muscle and pancreas tissues. Corresponding Myosin Light Chain 2 RNA-seq data are ...read more
Western Blot: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart tissue.
Immunohistochemistry-Frozen: Myosin Light Chain 2 Antibody [NBP1-85541] - Mlc2v staining on E11.5 mouse Right Ventricle. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody at 1ug/mL. Secondary antibody at ...read more
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Myosin Light Chain 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25299188). For IHC-Paraffin, HIER pH 6 retrieval is recommended. This Myosin Light Chain 2 Antibody is validated for IHC-Fr from a verified customer review.
Control Peptide
Myosin Light Chain 2 Protein (NBP1-85541PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85541 in the following applications:

Publications
Read Publication using
NBP1-85541 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25299188). Rat (82%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin Light Chain 2 Antibody

  • cardiac ventricular myosin light chain 2
  • CMH10myosin light chain 2
  • DKFZp779C0562
  • MLC2
  • MLC-2
  • MLC-2v
  • myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  • myosin, light chain 2, regulatory, cardiac, slow
  • myosin, light polypeptide 2, regulatory, cardiac, slow
  • regulatory light chain of myosin
  • RLC of myosin
  • slow cardiac myosin regulatory light chain 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP2-67486
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-62682
Species: Hu
Applications: IHC, IHC-P
AF2444
Species: Hu
Applications: IHC, WB
NBP2-03891
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-35336
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB9096
Species: Hu
Applications: IHC, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88068
Species: Hu
Applications: IHC, IHC-P
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP2-54719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP2-37958
Species: Hu
Applications: IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for Myosin Light Chain 2 Antibody (NBP1-85541)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for Myosin Light Chain 2 Antibody (NBP1-85541) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85541:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen Myosin Light Chain 2 NBP1-85541
Enlarge
5
reviewed by:
Verified Customer
IHC-Fr Mouse 01/07/2021
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedE11.5 mouse embryo fixed in 4% PFA
SpeciesMouse
LotA57970

Comments

CommentsFixed 4% PFA overnight.
Blocked with 1% BSA
Primary antibody concentration - 1ug/mL
Secondary antibody - Invitrogen Alexa Fluor 488
Secondary antibody - 1:1000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin Light Chain 2 Antibody (NBP1-85541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin Light Chain 2 Products

Bioinformatics Tool for Myosin Light Chain 2 Antibody (NBP1-85541)

Discover related pathways, diseases and genes to Myosin Light Chain 2 Antibody (NBP1-85541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin Light Chain 2 Antibody (NBP1-85541)

Discover more about diseases related to Myosin Light Chain 2 Antibody (NBP1-85541).
 

Pathways for Myosin Light Chain 2 Antibody (NBP1-85541)

View related products by pathway.

PTMs for Myosin Light Chain 2 Antibody (NBP1-85541)

Learn more about PTMs related to Myosin Light Chain 2 Antibody (NBP1-85541).

Blogs on Myosin Light Chain 2

There are no specific blogs for Myosin Light Chain 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
01/07/2021
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol MYL2