New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » Myosin Light Chain 2 » Myosin Light Chain 2 Antibodies » Myosin Light Chain 2 Antibody

Myosin Light Chain 2 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart muscle and pancreas tissues. Corresponding Myosin Light Chain 2 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart muscle and pancreas tissues. Corresponding Myosin Light Chain 2 RNA-seq data are ...read more
Western Blot: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart tissue.
Immunohistochemistry-Frozen: Myosin Light Chain 2 Antibody [NBP1-85541] - Mlc2v staining on E11.5 mouse Right Ventricle. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody at 1ug/mL. Secondary antibody at ...read more
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Myosin Light Chain 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25299188). For IHC-Paraffin, HIER pH 6 retrieval is recommended. This Myosin Light Chain 2 Antibody is validated for IHC-Fr from a verified customer review.
Control Peptide
Myosin Light Chain 2 Protein (NBP1-85541PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85541 in the following applications:
Publications
Read Publication using
NBP1-85541 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25299188). Rat (82%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin Light Chain 2 Antibody

  • cardiac ventricular myosin light chain 2
  • CMH10myosin light chain 2
  • DKFZp779C0562
  • MLC2
  • MLC-2
  • MLC-2v
  • myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  • myosin, light chain 2, regulatory, cardiac, slow
  • myosin, light polypeptide 2, regulatory, cardiac, slow
  • regulatory light chain of myosin
  • RLC of myosin
  • slow cardiac myosin regulatory light chain 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MLC1 Antibody
NBP1-81555
Western Blot: MLC1 Antibody [NBP1-81555] - Analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebellum shows moderate cytoplasmic positivity in neuropil of the molecular layer.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in perfusion fixed frozen sections of mouse skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(8 Reviews)
(73 Publications)
Species: All-Multi
Applications: ICC, IHC, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.
Species: Hu
Applications: IHC, IHC-P, WB
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry: Rhodopsin Antibody (B630) [NBP2-25160] - Rhodopsin expression and the prevalence of rod photoreceptors in the canine retina. (A) Fluorescence micrographs showing rhodopsin expression (red) in the ABCA4+/+ (left), ABCA4+/- (middle), and ABCA4-/- (right) rod outer segments. Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication. 50 ug of protein samples were resolved by SDS-PAGE, transferred to nitrocellulose membrane, and immunoblotted with the following primary antibodies: ABCA4 (NBP1-30032, 1:1000) and Rhodopsin (NBP2-25160, 1:5000), followed by Anti-Mouse IgG horseradish peroxidase-conjugated secondary antibody (R&D Systems, HAF007, 1:5000. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(4 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Myosin light chain
kinase Antibody (SU40 ...
NBP2-67486
Flow Cytometry: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Analysis of SH-SY-5Y cells with MYLK antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Staining MYLK in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Staining MYLK in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
preproANP Antibody
NBP2-14873
Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-14873] - Paraffin-embedded mouse muscle. preproANP antibody diluted at 1:500.
Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-14873] - Mouse heart. ANP stained by preproANP antibody diluted at 1:500.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-14873] - Mouse heart. preproANP stained by preproANP antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MYLK3 Antibody
NBP2-62682
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Analysis in human heart muscle and pancreas tissues using Anti-MYLK3 antibody. Corresponding MYLK3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human heart muscle shows high expression.
Species: Hu
Applications: IHC, IHC-P
NKX2.5 Antibody
AF2444
NKX2.5 Antibody
(2 Reviews)
(4 Publications)
Species: Hu
Applications: IHC, WB
MYL7 Antibody
(OTI4E7)
NBP2-03891
Flow Cytometry: MYL7 Antibody (4E7) [NBP2-03891] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-MYL7 antibody, and then analyzed by flow cytometry.
Western Blot: MYL7 Antibody (4E7) [NBP2-03891] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MYL7 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MYL7.
Immunohistochemistry-Paraffin: MYL7 Antibody (4E7) [NBP2-03891] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-MYL7 mouse monoclonal antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Troponin I Type 3
(cardiac) Antibody (2 ...
NBP2-35336
Western Blot: Troponin I Type 3 (cardiac) Antibody (2C9) [NBP2-35336] - Analysis of clone 2C9 in human heart at 0.5 and 1.0 ug/mL
Immunohistochemistry-Paraffin: Troponin I Type 3 (cardiac) Antibody (2C9) [NBP2-35336] - Analysis of FFPE tissue section of human heart using Troponin I antibody (clone 2C9) at 5 ug/mL concentration. The antibody specifically detected the target protein in cardiac muscle fibers in the tested sections, whereas, the nuclei as well as the intercellular collagen network did not develop any immunostaining.
Immunohistochemistry-Paraffin: Troponin I Type 3 (cardiac) Antibody (2C9) [NBP2-35336] - Formalin fixed tissue section of human breast with 5 ug/mL concentration of Troponin I Type 3 (cardiac) antibody (clone 2C9) showing no staining - Negative Control
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MYH7 Antibody
(940906) [Unconjugate
MAB9096
MYH7 was detected in immersion fixed paraffin-embedded sections of human heart using Mouse Anti-Human MYH7 Monoclonal Antibody (Catalog # MAB9096) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human skeletal muscle tissue and human heart (atrium) tissue. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human MYH7 Monoclonal Antibody (Catalog # MAB9096) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for MYH7 at approximately 230 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IHC, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC12 cells were fixed for 10 minutes using 4% PFA and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MHC Class I Antibody (OX18) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - Major histocompatibility complex (MHC) I and II as well as Transporter associated with antigen presentation II (TAPII) were analyzed, using immunocytochemistry on rat Schwann cells (SCs). Corresponding merges are shown in the bottom rows. Treatment of SCs with IL-17 was performed at concentrations of 0.5 and 50 ng/mL. Graphs to the right show densitometry quantification. SCs showed expression of MHCI > TAPII > MHCII, which increased after IL-17 treatment. MHCI was mainly detected in the cytoplasm and the expression increased in a dose-dependent manner after IL-17 treatment, significant for 0.5 ng/mL and 50 ng/mL (**P <=0.01). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-11-63), licensed under a CC-BY licence.
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Myosin light chain
3 Antibody
NBP1-88068
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Analysis in human heart muscle and lymph node tissues. Corresponding MYL3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Species: Hu
Applications: IHC, IHC-P
MyoD Antibody
(5.8A) - BSA Free
NB100-56511
Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Cell Lines Tested: mouse skeletal muscle-derived primary cell population Test Sample Preparation: mouse skeletal muscle digested by collagenase type 2 System: Super Sensitive High Resolution Confocal Laser Microscope (LSM880 with Airyscan) Excitation Wavelength: 488nm Emission Filter: 562 nm. Image using the DyLight 488 form of this antibody. ICC/IF image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Human myoblasts were stained with MyoD1 antibody, diluted 1:200. ICC/IF image submitted by a verified customer review.
Western Blot: MyoD Antibody (5.8A) [NB100-56511] - Insuline-like growth factor (IGF1) antagonized the effects of miR-106a-5p on myogenic differentiation in C2C12. All data were collected from C2C12 myotubes 5 d post differentiation. Western-blot analysis of myogenic regulatory factors (MyoD, MyoG, MyHC) in cells; (H) The statistical results of Figure 3G. Data were presented as mean +/- SEM. n = 3 per group. * p < 0.05, ** p < 0.01. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2073-4425/9/7/333/htm) licensed under a CC-BY licence. anti-MyoG (catalog# NB100-56510)
(2 Reviews)
(23 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
MRLC2 Antibody
NBP2-54719
Immunocytochemistry/Immunofluorescence: MRLC2 Antibody [NBP2-54719] - MRCL3 Antibody [NBP2-54719] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: MRCL3 Antibody [NBP2-54719] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
Western Blot: MRCL3 Antibody [NBP2-54719] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HESX1 Antibody
NBP1-89090
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts as well as in Leydig cells.
Species: Hu
Applications: IHC, IHC-P
Troponin C
(cardiac) Antibody
NBP2-37958
Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-37958] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-37958] - Staining of human skin shows low expression as expected.
Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-37958] - Staining in human heart muscle and skin tissues using anti-TNNC1 antibody. Corresponding TNNC1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for Myosin Light Chain 2 Antibody (NBP1-85541)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for Myosin Light Chain 2 Antibody (NBP1-85541) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85541:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen Myosin Light Chain 2 NBP1-85541
Enlarge 		5
reviewed by:
Verified Customer
 IHC-Fr Mouse 01/07/2021
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedE11.5 mouse embryo fixed in 4% PFA
SpeciesMouse
LotA57970

Comments

CommentsFixed 4% PFA overnight.
Blocked with 1% BSA
Primary antibody concentration - 1ug/mL
Secondary antibody - Invitrogen Alexa Fluor 488
Secondary antibody - 1:1000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin Light Chain 2 Antibody (NBP1-85541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin Light Chain 2 Products

Bioinformatics Tool for Myosin Light Chain 2 Antibody (NBP1-85541)

Discover related pathways, diseases and genes to Myosin Light Chain 2 Antibody (NBP1-85541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin Light Chain 2 Antibody (NBP1-85541)

Discover more about diseases related to Myosin Light Chain 2 Antibody (NBP1-85541).
 

Pathways for Myosin Light Chain 2 Antibody (NBP1-85541)

View related products by pathway.

PTMs for Myosin Light Chain 2 Antibody (NBP1-85541)

Learn more about PTMs related to Myosin Light Chain 2 Antibody (NBP1-85541).

Blogs on Myosin Light Chain 2

There are no specific blogs for Myosin Light Chain 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunohistochemistry-Frozen Myosin Light Chain 2 NBP1-85541
Enlarge
 Verified Customer
01/07/2021
Application: IHC-Fr
Species: Mouse
read this review

Bioinformatics

Gene Symbol MYL2