Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | MYL2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | IHC reported in scientific literature (PMID: 25299188). For IHC-Paraffin, HIER pH 6 retrieval is recommended. This Myosin Light Chain 2 Antibody is validated for IHC-Fr from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2), 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Prashan De Zoysa |
IHC-Fr | Mouse | 01/07/2021 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for Myosin Light Chain 2 Antibody (NBP1-85541)Discover more about diseases related to Myosin Light Chain 2 Antibody (NBP1-85541).
| Pathways for Myosin Light Chain 2 Antibody (NBP1-85541)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | MYL2 |