Myosin heavy chain 14 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 14 Antibody [NBP2-56586] - Staining of human cell line RT4 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myosin heavy chain 14 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYH14
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Myosin heavy chain 14 Recombinant Protein Antigen (NBP2-56586PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Myosin heavy chain 14 Antibody

  • DFNA4
  • DFNA4A
  • FP17425
  • MHC16
  • MYH14
  • MYH17
  • myosin, heavy chain 14, non-muscle
  • NMHC II-C
  • NMHC-II-C
  • PNMHH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-88071
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67486
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ch, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81555
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-62682
Species: Hu
Applications: IHC, IHC-P

Publications for Myosin heavy chain 14 Antibody (NBP2-56586) (0)

There are no publications for Myosin heavy chain 14 Antibody (NBP2-56586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin heavy chain 14 Antibody (NBP2-56586) (0)

There are no reviews for Myosin heavy chain 14 Antibody (NBP2-56586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Myosin heavy chain 14 Antibody (NBP2-56586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Myosin heavy chain 14 Products

Bioinformatics Tool for Myosin heavy chain 14 Antibody (NBP2-56586)

Discover related pathways, diseases and genes to Myosin heavy chain 14 Antibody (NBP2-56586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin heavy chain 14 Antibody (NBP2-56586)

Discover more about diseases related to Myosin heavy chain 14 Antibody (NBP2-56586).
 

Pathways for Myosin heavy chain 14 Antibody (NBP2-56586)

View related products by pathway.

PTMs for Myosin heavy chain 14 Antibody (NBP2-56586)

Learn more about PTMs related to Myosin heavy chain 14 Antibody (NBP2-56586).
 

Research Areas for Myosin heavy chain 14 Antibody (NBP2-56586)

Find related products by research area.

Blogs on Myosin heavy chain 14

There are no specific blogs for Myosin heavy chain 14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin heavy chain 14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH14