Myosin heavy chain 11 Antibody

Images

 
Immunohistochemistry-Paraffin: Myosin heavy chain Antibody [NBP1-87026] - Staining of human breast shows moderate positivity in myoepithelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myosin heavy chain 11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYH11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Myosin heavy chain 11 Recombinant Protein Antigen (NBP1-87026PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin heavy chain 11 Antibody

  • AAT4
  • FAA4
  • MYH11 myosin, heavy chain 11, smooth muscle
  • MYH11
  • SMHC
  • SMMHC
  • Smooth muscle myosin heavy chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7349
Species: Hu, Mu
Applications: WB, ICC
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB600-248
Species: Hu
Applications: WB, IP
NBP2-45545
Species: Hu
Applications: WB, IHC
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-49154
Species: Hu
Applications: IHC
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
MAB4028
Species: Hu, Mu
Applications: WB
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87026
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Myosin heavy chain 11 Antibody (NBP1-87026) (0)

There are no publications for Myosin heavy chain 11 Antibody (NBP1-87026).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin heavy chain 11 Antibody (NBP1-87026) (0)

There are no reviews for Myosin heavy chain 11 Antibody (NBP1-87026). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Myosin heavy chain 11 Antibody (NBP1-87026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin heavy chain 11 Products

Bioinformatics Tool for Myosin heavy chain 11 Antibody (NBP1-87026)

Discover related pathways, diseases and genes to Myosin heavy chain 11 Antibody (NBP1-87026). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin heavy chain 11 Antibody (NBP1-87026)

Discover more about diseases related to Myosin heavy chain 11 Antibody (NBP1-87026).
 

Pathways for Myosin heavy chain 11 Antibody (NBP1-87026)

View related products by pathway.

PTMs for Myosin heavy chain 11 Antibody (NBP1-87026)

Learn more about PTMs related to Myosin heavy chain 11 Antibody (NBP1-87026).

Blogs on Myosin heavy chain 11

There are no specific blogs for Myosin heavy chain 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin heavy chain 11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH11
Entrez
Uniprot