Myosin heavy chain 11 Antibody - BSA Free

Analysis in human prostate and skeletal muscle tissues Corresponding MYH11 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Myosin heavy chain 11 Antibody [NBP1-87025] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Myosin heavy chain 11 Antibody [NBP1-87025] - Staining of human heart muscle shows no postivity in cardiomyocytes as expected.

Immunohistochemistry-Paraffin: Myosin heavy chain 11 Antibody [NBP1-87025] - Staining of human liver shows no postivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Myosin heavy chain 11 Antibody [NBP1-87025] - Staining of human prostate shows very strong cytoplasmic postivity in smooth muscle cells.

Staining of human cell line U-2 OS shows positivity in nucleus.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Myosin heavy chain 11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Myosin heavy chain 11 Antibody - BSA Free (NBP1-87025) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYH11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Myosin heavy chain 11 Recombinant Protein Antigen (NBP1-87025PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Myosin heavy chain 11 Antibody - BSA Free

• AAT4
• FAA4
• MYH11 myosin, heavy chain 11, smooth muscle
• MYH11
• SMHC
• SMMHC
• Smooth muscle myosin heavy chain

Background

The protein encoded by the MYH11 gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. MYH11 functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. The gene encoding a human ortholog of rat NUDE1 is transcribed from the reverse strand of this gene, and its 3' end overlaps with that of the latter. The pericentric inversion of chromosome 16 [inv(16)(p13q22)] produces a chimeric transcript that encodes a protein consisting of the first 165 residues from the N terminus of core-binding factor beta in a fusion with the C-terminal portion of the smooth muscle myosin heavy chain. This chromosomal rearrangement is associated with acute myeloid leukemia of the M4Eo subtype. Alternative splicing generates isoforms that are differentially expressed, with ratios changing during muscle cell maturation. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Myosin heavy chain 11 Antibody (NBP1-87025)(1)

Publication using NBP1-87025

• Xuan W, Cheng F, Han X et al. Phenotypic Switching of Vascular Smooth Muscle Cells in Duchenne Muscular Dystrophy bioRxiv 2023-06-25 (IHC, ICC/IF, Mouse, Human)

Bioinformatics

• Gene Symbol: MYH11