Myosin heavy chain 1 Antibody


Western Blot: Myosin heavy chain 1 Antibody [NBP1-57681] - Sample Tissue: Human OVCAR-3 Antibody Dilution: 1.0 ug/ml
Western Blot: Myosin heavy chain 1 Antibody [NBP1-57681] - Human OVCAR-3.
Western Blot: Myosin heavy chain 1 Antibody [NBP1-57681] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Myosin heavy chain 1 Antibody Summary

Synthetic peptide corresponding to Myosin heavy chain 1 (myosin, heavy chain 1, skeletal muscle, adult) directed towards the N terminal of Myosin heavy chain 1. Peptide sequence: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Myosin heavy chain 1 and was validated on Western blot.
Theoretical MW
223 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Myosin heavy chain 1 Antibody

  • MyHC-2x
  • MYH1 myosin, heavy chain 1, skeletal muscle, adult
  • MYH1
  • MYHa
  • MYHC 1
  • MYHC1
  • MYHC-1
  • MyHC-2X/D
  • MYHSA1


Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Rt, Rb
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB

Publications for Myosin heavy chain 1 Antibody (NBP1-57681) (0)

There are no publications for Myosin heavy chain 1 Antibody (NBP1-57681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin heavy chain 1 Antibody (NBP1-57681) (0)

There are no reviews for Myosin heavy chain 1 Antibody (NBP1-57681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin heavy chain 1 Antibody (NBP1-57681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Myosin heavy chain 1 Products

Myosin heavy chain 1 NBP1-57681

Bioinformatics Tool for Myosin heavy chain 1 Antibody (NBP1-57681)

Discover related pathways, diseases and genes to Myosin heavy chain 1 Antibody (NBP1-57681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin heavy chain 1 Antibody (NBP1-57681)

Discover more about diseases related to Myosin heavy chain 1 Antibody (NBP1-57681).

Pathways for Myosin heavy chain 1 Antibody (NBP1-57681)

View related products by pathway.

PTMs for Myosin heavy chain 1 Antibody (NBP1-57681)

Learn more about PTMs related to Myosin heavy chain 1 Antibody (NBP1-57681).

Research Areas for Myosin heavy chain 1 Antibody (NBP1-57681)

Find related products by research area.

Blogs on Myosin heavy chain 1

There are no specific blogs for Myosin heavy chain 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Myosin heavy chain 1 Antibody and receive a gift card or discount.


Gene Symbol MYH1