Myosin 1A Antibody - BSA Free

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431] - Staining of human duodenum shows high expression.

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431] - Staining in human duodenum and liver tissues using anti-MYO1A antibody. Corresponding MYO1A RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Myosin 1A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Myosin 1A Antibody - BSA Free (NBP2-55431) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYO1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP)

Reactivity Notes

Mouse 82%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Myosin 1A Antibody - BSA Free

• BBMI
• BBM-I
• Brush border myosin I
• brush border myosin-I
• DFNA48
• MIHC
• MYHL
• Myosin I heavy chain
• myosin IA
• myosin, heavy polypeptide-like (100kD)
• myosin-Ia

Background

MYO1A, also known as Unconventional myosin-Ia, is a 1,043 amino acid protein that is 118 kDa, expressed by enterocytes, the epithelial cells that line the luminal surface of the small intestine, functions as actin-based molecular motor that, upon interaction with actin filaments, utilize energy from ATP hydrolysis to generate mechanical force, and potentially it is involved in directing the movement of organelles along actin filaments. Current research is being performed on this proteins involvement in deafness, autosomal dominant 48, spinal cord injury, brachial plexus injuries, sensorineural hearing loss, chronic obstructive pulmonary disease, myotonic dystrophy, pulmonary disease, t cell deficiency, and retinitis. The protein has been linked to the RhoA pathway, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, epithelial adherens junctions, cellular effects of sildenafil, ILK signaling, epithelial tight junctions, RhoGDI pathway, PAK pathway, and Fc-GammaR-mediated phagocytosis in macrophages pathways where it interacts with BAZ1B, FBL, MAP3K3, SMARCA5, USP20, NEK6, PHLDA3, and over 50 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYO1A