Myosin 1B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Myosin 1B Antibody [NBP1-87739] - Staining of human cell line A-431 shows positivity in plasma membrane and cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli and in cells in tubules.
Western Blot: Myosin 1B Antibody [NBP1-87739] - (B) Western blot of Myo1b from freshly isolated ATII cells and ATII cells after 2 days of culture (0 and 2, respectively) to demonstrate expression of Myo1b in ATII cells. ...read more
Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Western Blot: Myosin 1B Antibody [NBP1-87739] - Lysates of mouse whole brain in different developmental stages. Antibody at 1:1000. Molecular weight of the protein is around 130-140 KDa. Image submitted by a verified ...read more
Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human liver shows moderate membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, ChSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myosin 1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLNKLKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKIKDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYO1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25812521). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Myosin 1B antibody validated WB from a verified customer review.
Control Peptide
Myosin 1B Protein (NBP1-87739PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87739 in the following applications:

Publications
Read Publications using
NBP1-87739 in the following applications:

  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Chicken reactivity reported in scientific literature (PMID: 25812521). Rat reactivity reported in the scientific literature (PMID: 26940917). Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin 1B Antibody

  • MMIa
  • MMI-alpha
  • MYH-1c
  • MYO1B variant protein
  • Myosin I alpha
  • myosin IB
  • myosin-I alpha
  • myosin-Ib
  • myr1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19452
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87745
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-92158
Species: Hu
Applications: IHC, IHC-P, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
H00004642-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-31598
Species: Hu
Applications: IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-78537
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Myosin 1B Antibody (NBP1-87739)(3)

Review for Myosin 1B Antibody (NBP1-87739) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-87739:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Myosin 1B NBP1-87739
Enlarge
5
reviewed by:
Luiz Alexandre Magno
WB Mouse 10/17/2018
View

Summary

ApplicationWestern Blot
Sample Tested Mouse brain
SpeciesMouse
LotA39461

Comments

Commentst works very well at 1:1,000 in the brain but I would also suggest trying lower dilutions in tissues with lower expression of this type of myosin.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myosin 1B Antibody (NBP1-87739) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin 1B Products

Bioinformatics Tool for Myosin 1B Antibody (NBP1-87739)

Discover related pathways, diseases and genes to Myosin 1B Antibody (NBP1-87739). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin 1B Antibody (NBP1-87739)

Discover more about diseases related to Myosin 1B Antibody (NBP1-87739).
 

Pathways for Myosin 1B Antibody (NBP1-87739)

View related products by pathway.

PTMs for Myosin 1B Antibody (NBP1-87739)

Learn more about PTMs related to Myosin 1B Antibody (NBP1-87739).
 

Research Areas for Myosin 1B Antibody (NBP1-87739)

Find related products by research area.

Blogs on Myosin 1B

There are no specific blogs for Myosin 1B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Luiz Alexandre Magno
10/17/2018
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol MYO1B