Myocardin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Myocardin Antibody [NBP3-17398] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Myocardin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Myocardin Antibody - BSA Free (NBP3-17398) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VSSPISSQVCTAQNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQKMAGLHSSDKVGPKFSIPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYOCD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Myocardin Antibody - BSA Free

• BSAC2A
• MYCD
• Myocardin
• MYOCD
• Srfcp

Background

The Myocardin gene encodes a nuclear protein, which is expressed in heart, aorta, and in smooth muscle cell-containing tissues.It functions as a transcriptional co-activator of serum response factor (SRF) and modulates expression of cardiac andsmooth muscle-specif

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYOCD