Myocardin Antibody

Images

 
Western Blot: Myocardin Antibody [NBP1-74113] - Mouse Pancreas Lysate 1ug/ml Gel Concentration 6-18%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myocardin Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Myocd. Immunizing peptide sequence KSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYOCD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Myocd and was validated on Western blot.
Theoretical MW
106 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Myocardin Antibody

  • BSAC2A
  • MYCD
  • Myocardin
  • MYOCD
  • Srfcp

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-46209
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97918
Species: Hu, Po, Ca, Ch, Fe, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF3158
Species: Mu
Applications: WB, ChIP, ICC
NBP1-88518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74113
Species: Mu
Applications: WB

Publications for Myocardin Antibody (NBP1-74113) (0)

There are no publications for Myocardin Antibody (NBP1-74113).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myocardin Antibody (NBP1-74113) (0)

There are no reviews for Myocardin Antibody (NBP1-74113). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myocardin Antibody (NBP1-74113) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myocardin Products

Bioinformatics Tool for Myocardin Antibody (NBP1-74113)

Discover related pathways, diseases and genes to Myocardin Antibody (NBP1-74113). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myocardin Antibody (NBP1-74113)

Discover more about diseases related to Myocardin Antibody (NBP1-74113).
 

Pathways for Myocardin Antibody (NBP1-74113)

View related products by pathway.

PTMs for Myocardin Antibody (NBP1-74113)

Learn more about PTMs related to Myocardin Antibody (NBP1-74113).

Blogs on Myocardin

There are no specific blogs for Myocardin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myocardin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOCD
Entrez
Uniprot