MYL6 Antibody - BSA Free

Immunohistochemistry: MYL6 Antibody [NBP3-09356] - Immunohistochemical analysis of human prostate.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MYL6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MYL6 Antibody - BSA Free (NBP3-09356) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYL6 (NP_524147). Peptide sequence PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYL6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MYL6 Antibody - BSA Free

• ESMLC
• LC17
• LC17A
• LC17B
• LC17-GI
• LC17-NM
• MLC1SM
• MLC-3
• MLC3NM
• MLC3SM
• Myosin light chain 3
• Myosin light chain A3
• Myosin light chain alkali 3
• myosin light polypeptide 6,17 kDa myosin light chain
• myosin, light chain 6, alkali, smooth muscle and non-muscle
• myosin, light polypeptide 6, alkali, smooth muscle and non-muscle
• Smooth muscle and nonmuscle myosin light chain alkali 6

Background

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYL6