MYF6 Antibody - BSA Free

Staining of human cell line BJ [Human fibroblast] shows localization to nucleoplasm & mitotic spindle.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MYF6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MYF6 Antibody - BSA Free (NBP3-25003) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein MYF6 using the following amino acid sequence: FETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAP
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYF6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MYF6 Antibody - BSA Free

• bHLHc4BHLHC4
• Class C basic helix-loop-helix protein 4
• MRF4
• MRF4myogenic factor 6
• Muscle-specific regulatory factor 4
• myf-6
• myogenic factor 6 (herculin)

Background

MYF6 (Myogenic factor 6 or herculin) is a 242 amino acid basic helix-loop-helix DNA binding protein that is involved in muscle differentiation. It induces fibroblasts to differentiate into myoblasts. Defects in MYF6 may be a cause of centronuclear myopathy type 3. It may also play a role in muscular dystrophy, rhabdomyosarcoma, myopathy, centronuclear myopathy, alveolar soft part sarcoma and myasthenia gravis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYF6