Myelin expression factor 2 Antibody

Images

 
Western Blot: Myelin expression factor 2 Antibody [NBP1-83766] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Myelin expression factor 2 Antibody [NBP1-83766] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP1-83766] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myelin expression factor 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYEF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Myelin expression factor 2 Protein (NBP1-83766PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myelin expression factor 2 Antibody

  • FLJ11213
  • HsT18564
  • KIAA1341MSTP156
  • MEF-2myEF-2
  • MGC87325
  • MST156
  • MyEF-2
  • myelin expression factor 2
  • myelin gene expression factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NBP2-33286
Species: Hu
Applications: IHC, IHC-P
NBP1-69229
Species: Hu
Applications: WB
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Myelin expression factor 2 Antibody (NBP1-83766) (0)

There are no publications for Myelin expression factor 2 Antibody (NBP1-83766).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myelin expression factor 2 Antibody (NBP1-83766) (0)

There are no reviews for Myelin expression factor 2 Antibody (NBP1-83766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myelin expression factor 2 Antibody (NBP1-83766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myelin expression factor 2 Products

Bioinformatics Tool for Myelin expression factor 2 Antibody (NBP1-83766)

Discover related pathways, diseases and genes to Myelin expression factor 2 Antibody (NBP1-83766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myelin expression factor 2 Antibody (NBP1-83766)

Discover more about diseases related to Myelin expression factor 2 Antibody (NBP1-83766).
 

Pathways for Myelin expression factor 2 Antibody (NBP1-83766)

View related products by pathway.

Blogs on Myelin expression factor 2

There are no specific blogs for Myelin expression factor 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myelin expression factor 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYEF2