Aspartate beta hydroxylase Antibody


Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml ASPH is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229] - Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.
Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Aspartate beta hydroxylase Antibody Summary

Synthetic peptides corresponding to ASPH(aspartate beta-hydroxylase) The peptide sequence was selected from the N terminal of ASPH. Peptide sequence MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ASPH and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Aspartate beta hydroxylase Antibody

  • AAH
  • ASP beta-hydroxylase
  • aspartate beta-hydroxylaseA beta H-J-J
  • aspartyl/asparaginyl-beta-hydroxylase
  • BAH
  • cardiac junctin
  • CASQ2BP1
  • EC
  • HAAHaspartyl/asparaginyl beta-hydroxylase
  • humbug
  • JCTN
  • junctate
  • junctin
  • Peptide-aspartate beta-dioxygenase


ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for Aspartate beta hydroxylase Antibody (NBP1-69229) (0)

There are no publications for Aspartate beta hydroxylase Antibody (NBP1-69229).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aspartate beta hydroxylase Antibody (NBP1-69229) (0)

There are no reviews for Aspartate beta hydroxylase Antibody (NBP1-69229). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aspartate beta hydroxylase Antibody (NBP1-69229) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Aspartate beta hydroxylase Products

Bioinformatics Tool for Aspartate beta hydroxylase Antibody (NBP1-69229)

Discover related pathways, diseases and genes to Aspartate beta hydroxylase Antibody (NBP1-69229). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aspartate beta hydroxylase Antibody (NBP1-69229)

Discover more about diseases related to Aspartate beta hydroxylase Antibody (NBP1-69229).

Pathways for Aspartate beta hydroxylase Antibody (NBP1-69229)

View related products by pathway.

PTMs for Aspartate beta hydroxylase Antibody (NBP1-69229)

Learn more about PTMs related to Aspartate beta hydroxylase Antibody (NBP1-69229).

Research Areas for Aspartate beta hydroxylase Antibody (NBP1-69229)

Find related products by research area.

Blogs on Aspartate beta hydroxylase

There are no specific blogs for Aspartate beta hydroxylase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Aspartate beta hydroxylase Antibody and receive a gift card or discount.


Gene Symbol ASPH