MYCL1/L-Myc Antibody

Images

 
Western Blot: MYCL1/L-Myc Antibody [H00004610-B01P] - Analysis of MYCL1 expression in transfected 293T cell line by MYCL1 polyclonal antibody. Lane 1: MYCL1 transfected lysate(22.66 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MYCL1/L-Myc Antibody Summary

Immunogen
MYCL1 (NP_005367.1, 1 a.a. - 206 a.a.) full-length human protein. MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MYCL1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MYCL1/L-Myc Antibody

  • BHLHE38
  • bHLHe38myc-related gene from lung cancer
  • Class E basic helix-loop-helix protein 38
  • LMyc
  • L-Myc
  • LMYCl-myc-1 proto-oncogene
  • MYCL
  • MYCL1
  • protein L-Myc-1
  • v-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived
  • v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-46403
Species: Hu
Applications: IHC
H00004610-B01P
Species: Hu
Applications: WB

Publications for MYCL1/L-Myc Antibody (H00004610-B01P) (0)

There are no publications for MYCL1/L-Myc Antibody (H00004610-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYCL1/L-Myc Antibody (H00004610-B01P) (0)

There are no reviews for MYCL1/L-Myc Antibody (H00004610-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYCL1/L-Myc Antibody (H00004610-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYCL1/L-Myc Products

Bioinformatics Tool for MYCL1/L-Myc Antibody (H00004610-B01P)

Discover related pathways, diseases and genes to MYCL1/L-Myc Antibody (H00004610-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYCL1/L-Myc Antibody (H00004610-B01P)

Discover more about diseases related to MYCL1/L-Myc Antibody (H00004610-B01P).
 

Pathways for MYCL1/L-Myc Antibody (H00004610-B01P)

View related products by pathway.

PTMs for MYCL1/L-Myc Antibody (H00004610-B01P)

Learn more about PTMs related to MYCL1/L-Myc Antibody (H00004610-B01P).
 

Research Areas for MYCL1/L-Myc Antibody (H00004610-B01P)

Find related products by research area.

Blogs on MYCL1/L-Myc

There are no specific blogs for MYCL1/L-Myc, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYCL1/L-Myc Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYCL1
Entrez
Uniprot