MYBPC1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MYBPC1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYBPC1.
  
  

  Source: E. coli

  Amino Acid Sequence: DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MYBPC1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86427.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYBPC1 Recombinant Protein Antigen

• C-protein, skeletal muscle slow isoform
• MYBPCC
• MYBPCS
• myosin binding protein C, slow type
• myosin-binding protein C, slow-type
• skeletal muscle C-protein
• Slow MyBP-C
• slow-type

Background

MYBPC1, also known as Myosin-binding protein C, slow-type, is a protein with 10 isoforms ranging from a 1,120 amino acid isoform that is 126 kDa to a 1,173 amino acid isoform that is 131 kDa, located in the crossbridge region of vertebrate striated muscle a bands, plays an important role in muscle contraction by recruiting muscle-type creatine kinase to myosin filaments and modifies the activity of actin-activated myosin ATPase. Studies are being performed on the relationship of this protein to distal arthrogryposis, urethral intrinsic sphincter deficiency, akinetic mutism, hypertrophic cardiomyopathy, familial hypertrophic cardiomyopathy, dilated cardiomyopathy, dysgraphia, laryngeal squamous cell carcinoma, fg syndrome, atrial fibrillation, squamous cell carcinoma, mutism, muscular dystrophy, urethritis, polymyositis, laryngitis, dermatomyositis, myositis, distal arthrogryposis, and urethral intrinsic sphincter deficiency. MYBPC1 protein involvement has been observed with relation to CALM1, CALM2, CALM3, FHL1, MYBPC2, USP25, TTN, DYSF, ACTN2, and more than 30 other proteins in the muscle contraction and striated muscle contraction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MYBPC1