MYBBP1A Antibody - BSA Free

Immunohistochemistry: MYBBP1A Antibody [NBP3-38094] - Immunohistochemistry analysis of paraffin-embedded Rat lung using MYBBP1A Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: MYBBP1A Antibody [NBP3-38094] - Western blot analysis of various lysates using MYBBP1A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Immunohistochemistry: MYBBP1A Antibody [NBP3-38094] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using MYBBP1A Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: MYBBP1A Antibody [NBP3-38094] - Confocal immunofluorescence analysis of U2OS cells using MYBBP1A Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MYBBP1A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MYBBP1A Antibody - BSA Free (NBP3-38094) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1104-1328 of human MYBBP1A (NP_055335.2).
  
  Sequence:
  DLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMKTLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAATGGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQVNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKAQVRKAGKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYBBP1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 149 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MYBBP1A Antibody - BSA Free

• MYB binding protein (P160) 1a
• myb-binding protein 1A
• P160FLJ37886
• p53-activated protein-2
• PAP2

Background

Myb binding protein 1a (MYBBP1a) was originally isolated as a c-Myb interacting protein but has been found to associate with a number of transcription factors. MYBBP1a has been shown to activate or repress transcription through its interaction with transcriptional regulators such as AHR, jun, c-Myb, NF-kappaB, and PGC-1alpha.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYBBP1A