MYBBP1A Antibody

Images

 
Western Blot: MYBBP1A Antibody [NBP2-13630] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MYBBP1A Antibody [NBP2-13630] - Staining of human cell line U-2 OS shows positivity in nucleoli and vesicles.
Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Staining of human skin shows strong nuclear(nucleolar) positivity in epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYBBP1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQ EALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKA DLNIILSSPEQLELFLLAQQKVPSKLKKLVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYBBP1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
MYBBP1A Protein (NBP2-13630PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYBBP1A Antibody

  • MYB binding protein (P160) 1a
  • myb-binding protein 1A
  • P160FLJ37886
  • p53-activated protein-2
  • PAP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
H00085329-T01
Species: Hu
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for MYBBP1A Antibody (NBP2-13630) (0)

There are no publications for MYBBP1A Antibody (NBP2-13630).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYBBP1A Antibody (NBP2-13630) (0)

There are no reviews for MYBBP1A Antibody (NBP2-13630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MYBBP1A Antibody (NBP2-13630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYBBP1A Products

Bioinformatics Tool for MYBBP1A Antibody (NBP2-13630)

Discover related pathways, diseases and genes to MYBBP1A Antibody (NBP2-13630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYBBP1A Antibody (NBP2-13630)

Discover more about diseases related to MYBBP1A Antibody (NBP2-13630).
 

Pathways for MYBBP1A Antibody (NBP2-13630)

View related products by pathway.

PTMs for MYBBP1A Antibody (NBP2-13630)

Learn more about PTMs related to MYBBP1A Antibody (NBP2-13630).

Blogs on MYBBP1A

There are no specific blogs for MYBBP1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYBBP1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYBBP1A