MYBBP1A Antibody - BSA Free

Analysis in human cell line HEK 293 and human cell line SK-MEL-30.

Immunocytochemistry/Immunofluorescence: MYBBP1A Antibody [NBP2-13630] - Staining of human cell line U-2 OS shows positivity in nucleoli and vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Analysis in human skin and liver. Corresponding RNA-seq data are presented for the same tissues.

Staining of human liver shows no positivity in nucleoli in hepatocytes as expected.

Staining of human skin shows strong positivity in nucleoli in epidermal cells.

Analysis in human skin and liver tissues using NBP2-13630 antibody. Corresponding MYBBP1A RNA-seq data are presented for the same tissues.

Staining of human cerebral cortex shows strong positivity in nucleoli in neurons.

ChIP-Exo-Seq composite graph for Anti-MYBBP1A (NBP2-13630) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MYBBP1A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MYBBP1A Antibody - BSA Free (NBP2-13630) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYBBP1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  MYBBP1A Protein (NBP2-13630PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MYBBP1A Antibody - BSA Free

• MYB binding protein (P160) 1a
• myb-binding protein 1A
• P160FLJ37886
• p53-activated protein-2
• PAP2

Background

Myb binding protein 1a (MYBBP1a) was originally isolated as a c-Myb interacting protein but has been found to associate with a number of transcription factors. MYBBP1a has been shown to activate or repress transcription through its interaction with transcriptional regulators such as AHR, jun, c-Myb, NF-kappaB, and PGC-1alpha.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYBBP1A