MVD Antibody


Western Blot: MVD Antibody [NBP2-13629] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: MVD Antibody [NBP2-13629] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MVD Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQ PRLQACLREIRCLARKRRNSRDGD
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MVD Protein (NBP2-13629PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MVD Antibody

  • EC
  • FP17780
  • MDDase
  • mevalonate (diphospho) decarboxylase
  • Mevalonate (diphospho)decarboxylase
  • Mevalonate pyrophosphate decarboxylase
  • MPDdiphosphomevalonate decarboxylase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
Species: Hu
Applications: WB, ChIP, ELISA
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, PLA
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for MVD Antibody (NBP2-13629) (0)

There are no publications for MVD Antibody (NBP2-13629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MVD Antibody (NBP2-13629) (0)

There are no reviews for MVD Antibody (NBP2-13629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MVD Antibody (NBP2-13629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MVD Products

Bioinformatics Tool for MVD Antibody (NBP2-13629)

Discover related pathways, diseases and genes to MVD Antibody (NBP2-13629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MVD Antibody (NBP2-13629)

Discover more about diseases related to MVD Antibody (NBP2-13629).

Pathways for MVD Antibody (NBP2-13629)

View related products by pathway.

PTMs for MVD Antibody (NBP2-13629)

Learn more about PTMs related to MVD Antibody (NBP2-13629).

Research Areas for MVD Antibody (NBP2-13629)

Find related products by research area.

Blogs on MVD

There are no specific blogs for MVD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MVD Antibody and receive a gift card or discount.


Gene Symbol MVD