MuSK Antibody (2H6) Summary
Immunogen |
MUSK (NP_005583, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA |
Specificity |
MUSK (2H6) |
Isotype |
IgG2b Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
MUSK |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
Control |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MuSK Antibody (2H6)
Background
Intercellular communication is often mediated by receptors on the surface of one cell that recognize and are activated by specific protein ligands released by other cells. Members of one class of cell surface receptors, receptor tyrosine kinases (RTKs), are characterized by having a cytoplasmic domain containing intrinsic tyrosine kinase activity. This kinase activity is regulated by the binding of a cognate ligand to the extracellular portion of the receptor. DeChiara et al. (1996) [PubMed 8653786] noted that the RTKs, known to be expressed in cell type-specific fashions, play a role critical for the growth and differentiation of those cell types. For example, members of the neural-specific TRK family that recognize nerve growth factor are absolutely required for the survival and development of discrete neuronal subpopulations, and the receptor tyrosine kinases TIE1 (MIM 600222) and TIE2 (MIM 600221) play a critical role in the development of normal blood vessels.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: BA, BA
Species: Hu
Applications: ICC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Publications for MuSK Antibody (H00004593-M07) (0)
There are no publications for MuSK Antibody (H00004593-M07).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MuSK Antibody (H00004593-M07) (0)
There are no reviews for MuSK Antibody (H00004593-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MuSK Antibody (H00004593-M07) (0)
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Additional MuSK Products
Bioinformatics Tool for MuSK Antibody (H00004593-M07)
Discover related pathways, diseases and genes to MuSK Antibody (H00004593-M07). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MuSK Antibody (H00004593-M07)
Discover more about diseases related to MuSK Antibody (H00004593-M07).
| | Pathways for MuSK Antibody (H00004593-M07)
View related products by pathway.
|
PTMs for MuSK Antibody (H00004593-M07)
Learn more about PTMs related to MuSK Antibody (H00004593-M07).
| | Research Areas for MuSK Antibody (H00004593-M07)
Find related products by research area.
|
Blogs on MuSK