MURC Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MURC Antibody [NBP1-86609] - Staining of human cell line RH-30 shows localization to nucleoplasm, plasma membrane & the Golgi apparatus. Antibody staining is shown in green.

Staining of human lymphoid tissues, pancreas, skeletal muscle and testis using Anti-MURC antibody NBP1-86609 (A) shows similar protein distribution across tissues to independent antibody NBP1-86608 (B).

Analysis in human skeletal muscle and pancreas tissues Corresponding MURC RNA-seq data are presented for the same tissues.

Staining of human skeletal muscle shows strong membranous positivity in myocytes.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human skeletal muscle shows high expression.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and MURC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MURC Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MURC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  MURC Protein (NBP1-86609PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26086601).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MURC Antibody - BSA Free

• muscle-related coiled-coil protein
• Muscle-restricted coiled-coil protein

Background

Induces RHOA activation and activates NPPA transcription and myofibrillar organization through the Rho/ROCKsignaling pathway

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MURC Antibody (NBP1-86609)(1)

Publication using NBP1-86609

• Faggi F, Codenotti S, Poliani PL et al. MURC/cavin-4 Is Co-Expressed with Caveolin-3 in Rhabdomyosarcoma Tumors and Its Silencing Prevents Myogenic Differentiation in the Human Embryonal RD Cell Line. PLoS One 2015-01-01 [PMID: 26086601] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: MURC