MURC Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining in human skeletal muscle and pancreas tissues using anti-MURC antibody. Corresponding MURC RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human cerebral cortex, colon, pancreas and skeletal muscle using Anti-MURC antibody NBP1-86609 (A) shows similar ...read more
Western Blot: MURC Antibody [NBP1-86609] - Analysis in control (vector only transfected HEK293T lysate) and MURC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MURC Antibody [NBP1-86609] - Staining of human cell line RH-30 shows localization to nucleoplasm, plasma membrane & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human colon.
Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MURC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MURC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 26086601). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
MURC Protein (NBP1-86609PEP)
Publications
Read Publication using
NBP1-86609 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26086601).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MURC Antibody

  • muscle-related coiled-coil protein
  • Muscle-restricted coiled-coil protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5759
Species: Hu, Mu
Applications: WB
NBP1-80220
Species: Hu, Mu
Applications: IHC, IHC-P, KO, WB
NBP1-45210
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-46224
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
NB110-5029
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-49552
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-86609
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MURC Antibody (NBP1-86609)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MURC Antibody (NBP1-86609) (0)

There are no reviews for MURC Antibody (NBP1-86609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MURC Antibody (NBP1-86609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MURC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MURC