MURC Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MURC Antibody [NBP1-86607] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86607] - Staining of human skeletal muscle shows moderate membranous positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MURC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MURC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MURC Protein (NBP1-86607PEP)
Publications
Read Publication using NBP1-86607.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%). Reactivity reported in scientific literature (PMID: 23272181)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MURC Antibody

  • muscle-related coiled-coil protein
  • Muscle-restricted coiled-coil protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-44090
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80220
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-44091
Species: Hu
Applications: WB, ELISA, IHC
NBP2-46224
Species: Hu
Applications: WB, IHC
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-49552
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00006192-P01
Species: Hu

Publications for MURC Antibody (NBP1-86607)(1)


Reviews for MURC Antibody (NBP1-86607) (0)

There are no reviews for MURC Antibody (NBP1-86607). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MURC Antibody (NBP1-86607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MURC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MURC