MURC Antibody - BSA Free

Analysis in human skeletal muscle and pancreas tissues Corresponding MURC RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86607] - Staining of human skeletal muscle shows high expression.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human lymphoid tissues, pancreas, skeletal muscle and testis using Anti-MURC antibody NBP1-86607 (A) shows similar protein distribution across tissues to independent antibody NBP1-86609 (B).

Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86607] - Staining of human colon.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MURC Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MURC Antibody - BSA Free (NBP1-86607) is a polyclonal antibody validated for use in IHC. Anti-MURC Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MURC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MURC Protein (NBP1-86607PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%). Reactivity reported in scientific literature (PMID: 23272181)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MURC Antibody - BSA Free

• muscle-related coiled-coil protein
• Muscle-restricted coiled-coil protein

Background

Induces RHOA activation and activates NPPA transcription and myofibrillar organization through the Rho/ROCKsignaling pathway

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MURC Antibody (NBP1-86607)(1)

Publication using NBP1-86607

• Tassin A, Leroy B, Laoudj-Chenivesse D et al. FSHD Myotubes with Different Phenotypes Exhibit Distinct Proteomes. PLoS One 2012-01-01 [PMID: 23272181]

Bioinformatics

• Gene Symbol: MURC