MUM1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MUM1 Antibody [NBP2-13627] - Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MUM1 Antibody [NBP2-13627] - Staining of human heart muscle shows distinct staining of intercalated disc in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MUM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APLEELAYRRSLRVALDVLSEGSIWSQESSAGTGRADRSLRGKPMEHVSS PCDSNSSSLPRGDVLGSSRPHRRRPCVQQSLSSSFTCEKDPECKVDHKKG LRKSENPR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MUM1 Protein (NBP2-13627PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUM1 Antibody

  • EXPAND1
  • FLJ14868
  • FLJ22283
  • melanoma associated antigen (mutated) 1
  • melanoma ubiquitous mutated protein
  • MGC131891
  • MGC163315
  • MUM-1HSPC211
  • Mutated melanoma-associated antigen 1
  • Protein expandere
  • PWWP domain-containing protein MUM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF5525
Species: Hu
Applications: WB, IHC
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
NBP2-13627
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MUM1 Antibody (NBP2-13627) (0)

There are no publications for MUM1 Antibody (NBP2-13627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUM1 Antibody (NBP2-13627) (0)

There are no reviews for MUM1 Antibody (NBP2-13627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MUM1 Antibody (NBP2-13627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUM1 Products

Bioinformatics Tool for MUM1 Antibody (NBP2-13627)

Discover related pathways, diseases and genes to MUM1 Antibody (NBP2-13627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUM1 Antibody (NBP2-13627)

Discover more about diseases related to MUM1 Antibody (NBP2-13627).
 

Pathways for MUM1 Antibody (NBP2-13627)

View related products by pathway.

PTMs for MUM1 Antibody (NBP2-13627)

Learn more about PTMs related to MUM1 Antibody (NBP2-13627).
 

Research Areas for MUM1 Antibody (NBP2-13627)

Find related products by research area.

Blogs on MUM1

There are no specific blogs for MUM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MUM1