Recombinant Human MUC5AC GST (N-Term) Protein

Images

 
Recombinant Human Mucin 5AC Protein [H00004586-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human MUC5AC GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 351-450 of Human Mucin 5AC

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MUC5AC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
H00004586-Q01 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MUC5AC GST (N-Term) Protein

  • gastric mucin
  • leB
  • lewis B blood group antigen
  • major airway glycoprotein
  • MUC5
  • mucin 5, subtypes A and C, tracheobronchial/gastric
  • mucin 5AC, oligomeric mucus/gel-forming pseudogene
  • mucin 5AC, oligomeric mucus/gel-forming
  • mucin-5 subtype AC, tracheobronchial
  • mucin-5AC
  • TBM
  • tracheobronchial mucin

Background

Mucin 5, subtype AC (MUC5AC) is a gel-forming secreted mucin that functions as a protective barrier on surface of epithelial tissues (1-2). MUC5AC is expressed primarily by goblet cells of the surface epithelium, including in the stomach, respiratory tract, gall bladder, endocervix, and endometrium (1-3). Human MUC5AC is located on chromosome 11p15.5, consisting of 5654 amino acids and has a N-terminus, tandem-repeat region (TRR), and a C-terminus, with a theoretical molecular weight of ~585 kDa (1-4). More specifically, the N-terminus contains four von Willebrand factor type D domains, where D1 also has a leucine zipper pattern (1). The TRR is further divided into nine CysD domains and four PTS-rich tandem repeats (1). Finally, the C-terminus has a D4-, B-, C-, and CK-domain (1). The TRR is a site of heavy O-glycosylation that functions in gel and polypeptide formation (1,3).

Given that MUC5AC is the primary mucin produced and secreted by cells lining airway, it is understandable that its expression is dysregulated in a number of respiratory diseases (1,3,5,6). For instance, MUC5AC is overexpressed in asthma and the protein is also more highly glycosylated, specifically fucosylated, in the disease state (1,3,7). Additionally, its overproduction is a key feature in chronic obstructive pulmonary disease (COPD) contributing to mucosal blockage (6). Multiple pathways are associated with overproduction of MUC5AC including NFkappaB, the primary pathway for production and secretion, and also the MAPK and STAT6 pathways (3). In addition to conventional, synthetic therapeutics agents, researchers are exploring natural MUC5AC inhibitors such as flavonoids, glycosides, and steroids to treat associated disorders (3).

References

1. Krishn, S. R., Ganguly, K., Kaur, S., & Batra, S. K. (2018). Ramifications of secreted mucin MUC5AC in malignant journey: a holistic view. Carcinogenesis. https://doi.org/10.1093/carcin/bgy019

2. Ballester, B., Milara, J., & Cortijo, J. (2019). Mucins as a New Frontier in Pulmonary Fibrosis. Journal of clinical medicine. https://doi.org/10.3390/jcm8091447

3. Samsuzzaman, M., Uddin, M. S., Shah, M. A., & Mathew, B. (2019). Natural inhibitors on airway mucin: Molecular insight into the therapeutic potential targeting MUC5AC expression and production. Life sciences. https://doi.org/10.1016/j.lfs.2019.05.041

4. Uniprot (P98088)

5. Li, J., & Ye, Z. (2020). The Potential Role and Regulatory Mechanisms of MUC5AC in Chronic Obstructive Pulmonary Disease. Molecules (Basel, Switzerland). https://doi.org/10.3390/molecules25194437

6. Bonser, L. R., & Erle, D. J. (2017). Airway Mucus and Asthma: The Role of MUC5AC and MUC5B. Journal of clinical medicine. https://doi.org/10.3390/jcm6120112

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr,  IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP2-44374
Species: Hu
Applications: Flow, ICC/IF, IF, IHC,  IHC-P, IP, WB
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00004585-M07
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
DY413
Species: Mu
Applications: ELISA
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-44814
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-44434
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
NB100-2136
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB (-)
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DY4517-05
Species: Mu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-82045
Species: Hu
Applications: IHC,  IHC-P
H00004586-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for MUC5AC Partial Recombinant Protein (H00004586-Q01)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MUC5AC Partial Recombinant Protein (H00004586-Q01) (0)

There are no reviews for MUC5AC Partial Recombinant Protein (H00004586-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC5AC Partial Recombinant Protein (H00004586-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I recently bought several recombinant human mucins from your company, Mucin 4--cat# H00004585-Q01, mucin 5b--cat# H00727897-Q01, mucin 5ac--cat # H00004586-Q01. I would like to know what cell lines were used to make these recombinant proteins and whether they are glycosylated.
    • The proteins you inquired about were produced in the wheat germ protein expression system which is a cell free protein synthesis system. This system does not allow protein glycosylation. Please view more details about Abnova's cell free protein synthesis system (http://www.abnova.com/support/technologies.asp?switchfunctionid={539614B1-7CBB-4068-A93B-1B44DC6F2801})

Additional MUC5AC Products

Research Areas for MUC5AC Partial Recombinant Protein (H00004586-Q01)

Find related products by research area.

Blogs on MUC5AC.

Spheroids vs. Organoids: Which 3D Cell Culture Model is Best for You?
By Jennifer Jones, M.S.Spheroids and organoids are two words that, like “butter” and “margarine”, are often referred to interchangeably but have distinct meanings. The progression and adopt...  Read full blog post.

Customers Who Bought This Also Bought

MUC5AC Antibody (45M1)
NBP2-15196-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MUC5AC GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC5AC