MUC4 Antibody - BSA Free

Immunohistochemistry-Paraffin: MUC4 Antibody [NBP1-86505] - Staining of human lung cancer, adenocarcinoma shows moderate cytoplasmic positivity in tumor cells.

Immunohistochemistry-Paraffin: MUC4 Antibody [NBP1-86505] - Staining of human small intestine shows strong positivity in mucus in goblet cells.

Immunohistochemistry-Paraffin: MUC4 Antibody [NBP1-86505] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MUC4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MUC4 Antibody - BSA Free (NBP1-86505) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IQYTSNAEDANFTLRDSCTDLELFENGTLLWTPKSLEPFTLEILARSAKIGLASALQPRTVVCHCNAESQCLYNQTSRVGNSSLEVAGCKCDGGTFGRYCEGSEDACEEPCFPSVHCVPGKGCEACPPNLTGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MUC4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MUC4 Recombinant Protein Antigen (NBP1-86505PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MUC4 Antibody - BSA Free

• Ascites sialoglycoprotein
• ASGP
• HSA276359
• MUC4
• MUC-4
• mucin 4, cell surface associated
• mucin 4, tracheobronchial
• mucin-4
• Pancreatic adenocarcinoma mucin
• Testis mucin
• Tracheobronchial mucin

Background

MUC4 is a constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, and is a highly glycosylated proteins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. MUC4 antibody studies have shown that MUC4 encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of MUC4 have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. MUC4 is expressed in a wide variety of carcinomas making MUC4 antibodies a key cancer research tool.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MUC4