mtTFA Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: mtTFA Antibody [NBP1-86959] - Staining of human cell line U-2 OS shows positivity in mitochondria.

Immunohistochemistry-Paraffin: mtTFA Antibody [NBP1-86959] - Staining of human testis shows strong granular cytoplasmic positivity in a subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: mtTFA Antibody [NBP1-86959] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: mtTFA Antibody [NBP1-86959] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: mtTFA Antibody [NBP1-86959] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.

Western Blot: mtTFA Antibody [NBP1-86959] - Analysis in human cell lines Caco-2 and HeLa using anti-TFAM antibody. Corresponding TFAM RNA-seq data are presented for the same cell lines. Loading control: anti-PARP1.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

mtTFA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit mtTFA Antibody - BSA Free (NBP1-86959) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-mtTFA Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFAM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 23172368). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  mtTFA Protein (NBP1-86959PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for mtTFA Antibody - BSA Free

• mitochondrial transcription factor A
• MtTF1
• mtTFA
• TCF-6
• TCF6L1
• TCF6L2Mitochondrial transcription factor 1
• TCF6TCF6L3
• Transcription factor 6
• Transcription factor 6-like 2 (mitochondrial transcription factor)
• Transcription factor 6-like 2
• transcription factor A, mitochondrial

Background

TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for mtTFA Antibody (NBP1-86959)(1)

Publication using NBP1-86959

• Sotgia F, Whitaker-Menezes D, Martinez-Outschoorn UE et al. Mitochondria fuel breast cancer metabolism: Fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle 2012-12-01 [PMID: 23172368] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: TFAM