Immunocytochemistry/ Immunofluorescence: mtTFA Antibody [NBP1-86959] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: mtTFA Antibody [NBP1-86959] - Staining of human testis shows strong granular cytoplasmic positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: mtTFA Antibody [NBP1-86959] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: mtTFA Antibody [NBP1-86959] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: mtTFA Antibody [NBP1-86959] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.
Orthogonal Strategies: Western Blot: mtTFA Antibody [NBP1-86959] - Analysis in human cell lines Caco-2 and HeLa using anti-TFAM antibody. Corresponding TFAM RNA-seq data are presented for the same cell lines. ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: AELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFAM
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IHC reported in scientific literature (PMID: 23172368). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our mtTFA Antibody - BSA Free and receive a gift card or discount.