TFB1M Antibody

Images

 
Western Blot: TFB1M Antibody [NBP2-13429] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: TFB1M Antibody [NBP2-13429] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFB1M Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQP FKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLR PRQLSISHFKSLCDVYRKMCDEDPQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFB1M
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TFB1M Protein (NBP2-13429PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TFB1M Antibody

  • CGI75
  • CGI-75
  • dimethyladenosine transferase 1, mitochondrial
  • EC 2.1.1
  • EC 2.1.1.-
  • h-mtTFB
  • h-mtTFB1
  • homolog of yeast mitochondrial transcription factor B
  • hTFB1M
  • Mitochondrial 12S rRNA dimethylase 1
  • mitochondrial dimethyladenosine transferase 1
  • Mitochondrial transcription factor B1
  • mtTFB
  • mtTFB1
  • S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 1
  • transcription factor B1, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-19436
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92144
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82985
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13429
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TFB1M Antibody (NBP2-13429) (0)

There are no publications for TFB1M Antibody (NBP2-13429).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFB1M Antibody (NBP2-13429) (0)

There are no reviews for TFB1M Antibody (NBP2-13429). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFB1M Antibody (NBP2-13429) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFB1M Products

Bioinformatics Tool for TFB1M Antibody (NBP2-13429)

Discover related pathways, diseases and genes to TFB1M Antibody (NBP2-13429). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFB1M Antibody (NBP2-13429)

Discover more about diseases related to TFB1M Antibody (NBP2-13429).
 

Pathways for TFB1M Antibody (NBP2-13429)

View related products by pathway.

PTMs for TFB1M Antibody (NBP2-13429)

Learn more about PTMs related to TFB1M Antibody (NBP2-13429).
 

Research Areas for TFB1M Antibody (NBP2-13429)

Find related products by research area.

Blogs on TFB1M

There are no specific blogs for TFB1M, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFB1M Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFB1M