mtTFA Antibody (4H2M9)

Western Blot: mtTFA Antibody (4H2M9) [NBP3-16154] - Western blot analysis of various lysates, using TmtTFA Rabbit mAb at 1:1200 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: mtTFA Antibody (4H2M9) [NBP3-16154] - Confocal imaging of paraffin-embedded Human colon cancer tissue using mtTFA Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: mtTFA Antibody (4H2M9) [NBP3-16154] - Confocal imaging of paraffin-embedded Human kidney tissue using mtTFA Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: mtTFA Antibody (4H2M9) [NBP3-16154] - Immunohistochemistry analysis of paraffin-embedded Human brain tissue using mtTFA Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: mtTFA Antibody (4H2M9) [NBP3-16154] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using mtTFA Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: mtTFA Antibody (4H2M9) [NBP3-16154] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using mtTFA Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 4H2M9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

mtTFA Antibody (4H2M9) Summary

• Description: Novus Biologicals Rabbit mtTFA Antibody (4H2M9) (NBP3-16154) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human mtTFA (NP_003192.1). QDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELY
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TFAM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:10000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for mtTFA Antibody (4H2M9)

• mitochondrial transcription factor A
• MtTF1
• mtTFA
• TCF-6
• TCF6L1
• TCF6L2Mitochondrial transcription factor 1
• TCF6TCF6L3
• Transcription factor 6
• Transcription factor 6-like 2 (mitochondrial transcription factor)
• Transcription factor 6-like 2
• transcription factor A, mitochondrial

Background

TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFAM