MTHFD2 Antibody - BSA Free

Western Blot: MTHFD2 Antibody [NBP3-35135] - Western blot analysis of various lysates using MTHFD2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: MTHFD2 Antibody [NBP3-35135] - Immunofluorescence analysis of NIH-3T3 cells using MTHFD2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: MTHFD2 Antibody [NBP3-35135] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using MTHFD2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: MTHFD2 Antibody [NBP3-35135] - Immunohistochemistry analysis of paraffin-embedded Human mammary cancer using MTHFD2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: MTHFD2 Antibody [NBP3-35135] - Immunofluorescence analysis of C6 cells using MTHFD2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: MTHFD2 Antibody [NBP3-35135] - Immunofluorescence analysis of U-2 OS cells using MTHFD2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: MTHFD2 Antibody [NBP3-35135] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using MTHFD2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: MTHFD2 Antibody [NBP3-35135] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using MTHFD2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MTHFD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MTHFD2 Antibody - BSA Free (NBP3-35135) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-250 of human MTHFD2 (NP_006627.2).
  
  Sequence:
  ISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTHFD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MTHFD2 Antibody - BSA Free

• bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase
• methenyltetrahydrofolate cyclohydrolase
• methylene tetrahydrofolate dehydrogenase (NAD+ dependent)
• methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2
• mitochondrial
• NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase
• NMDMC

Background

MTHFD2 encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in multiple transcripts encoding different isoforms. This gene has a pseudogene on chromosome 7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTHFD2