MTHFD1L Antibody [mFluor Violet 610 SE] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 759-978 of human MTHFD1L (NP_056255.2).
Sequence: GVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MTHFD1L |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for MTHFD1L Antibody [mFluor Violet 610 SE]
Background
MTHFD1L, also known as Monofunctional C1-tetrahydrofolate synthase, mitochondrial, consists of 2 a 978 amino acid isoform1 that is 106 kDa and a 275 amino acid isoform 2 that is 30 kDa; has mitochondrion subcellular location and highest expression found in placenta, thymus and brain; it is involved in the synthesis of tetrahydrofolate (THF) in the mitochondrion which is important in the de novo synthesis of purines and thymidylate and in the regeneration of methionine from homocysteine, and also may provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2. Current research is being performed on this protein involvement in cleft lip/palate, neural tube defect, homocysteine, coronary heart disease, chronic myeloid leukemia, Down syndrome, colon adenocarcinoma, nephropathy, Alzheimer's disease, dementia, colorectal cancer, leukemia, and atherosclerosis. This protein plays role in One carbon pool by folate and Metabolic pathways where it interacts with CASP4, MAGED1, WRAP73, WDR8, MAP1LC3A, and plus more than 40 other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Fe, Hu, RM
Applications: BA, BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: Block, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for MTHFD1L Antibody (NBP3-38490MFV610) (0)
There are no publications for MTHFD1L Antibody (NBP3-38490MFV610).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MTHFD1L Antibody (NBP3-38490MFV610) (0)
There are no reviews for MTHFD1L Antibody (NBP3-38490MFV610).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MTHFD1L Antibody (NBP3-38490MFV610) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MTHFD1L Products
Blogs on MTHFD1L