MTHFD1 Antibody

Images

 
Western Blot: MTHFD1 Antibody [NBP1-82611] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-432
Immunohistochemistry-Paraffin: MTHFD1 Antibody [NBP1-82611] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTHFD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKPGKWMIQYNNLNLKTPVPSDIDISRSCKPKPIGKLAREIGLLSEEVELYGETKAKVLLSALEGAPHR
Marker
Cytoplasm Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTHFD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MTHFD1 Protein (NBP1-82611PEP)
Publications
Read Publication using
NBP1-82611 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24169621).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTHFD1 Antibody

  • C1-THF synthase
  • EC 6.3.4.3
  • methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methylenetetrahydrofolatecyclohydrolase, 10-formyltetrahydrofolate synthetase
  • methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1
  • MTHFCC-1-tetrahydrofolate synthase, cytoplasmic
  • MTHFDcytoplasmic C-1-tetrahydrofolate synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-57749
Species: Hu
Applications: WB, IHC
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-37863
Species: Hu
Applications: WB, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-24750
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
NBP1-82611
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MTHFD1 Antibody (NBP1-82611)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MTHFD1 Antibody (NBP1-82611) (0)

There are no reviews for MTHFD1 Antibody (NBP1-82611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTHFD1 Antibody (NBP1-82611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTHFD1 Products

Bioinformatics Tool for MTHFD1 Antibody (NBP1-82611)

Discover related pathways, diseases and genes to MTHFD1 Antibody (NBP1-82611). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTHFD1 Antibody (NBP1-82611)

Discover more about diseases related to MTHFD1 Antibody (NBP1-82611).
 

Pathways for MTHFD1 Antibody (NBP1-82611)

View related products by pathway.

PTMs for MTHFD1 Antibody (NBP1-82611)

Learn more about PTMs related to MTHFD1 Antibody (NBP1-82611).
 

Research Areas for MTHFD1 Antibody (NBP1-82611)

Find related products by research area.

Blogs on MTHFD1

There are no specific blogs for MTHFD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTHFD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTHFD1